KEGG   Kytococcus sedentarius: Ksed_08980Help
Entry
Ksed_08980        CDS       T00974                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
kse  Kytococcus sedentarius
Pathway
kse00010  Glycolysis / Gluconeogenesis
kse00030  Pentose phosphate pathway
kse00051  Fructose and mannose metabolism
kse00052  Galactose metabolism
kse00680  Methane metabolism
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_08980
   00030 Pentose phosphate pathway
    Ksed_08980
   00051 Fructose and mannose metabolism
    Ksed_08980
   00052 Galactose metabolism
    Ksed_08980
  Energy metabolism
   00680 Methane metabolism
    Ksed_08980
Enzymes [BR:kse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ksed_08980
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Ksed_08980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACV05946
UniProt: C7NFL1
Position
916455..917477
Genome map
AA seq 340 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRGAVLKGDRIHGHEFLGIKDGWRGLVEDDVAPLPRHQIRGL
SKQGGTILGTSRVGPYGEGNGGAQRVRETMQRRGMDALIAIGGEGTLTVARMLHDEGIDV
VGVPKTIDNDLGATDYTFGFDTAVHVATEAIDRLRTTGDSHHRCMVLEVMGRHAGWIALH
AGIAGGAHAVLIPEVAVGYDQVAQWVRATADRGRAPMVVVAEGFMPDGELVSGGQVDGMG
RPRLGGVGEQVAREIEERTGIESRAMALGHMQRGGSPTAYDRVLATRFGTAALDAVHDRA
FGQMVALAGTEIVRVPLAEATTALKSVPRERWDEAAILFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcatcctgacctccggcggggactgccccggtctcaacgccgtcatccgc
ggagccgtcctcaagggcgatcgcatccacggccacgagttcctcggcatcaaggacggt
tggcggggcctggtcgaggacgacgtcgcgcccctgccccgccaccagatccgcggcctg
agcaagcagggcggcaccatcctgggcacctcccgggtgggtccctacggcgagggcaac
gggggcgcccagcgcgtccgcgagaccatgcagcggcgcgggatggacgccctcatcgcc
atcgggggagagggcacgctcaccgtggcgcggatgctccacgacgagggcatcgacgtg
gtgggggtccccaagaccatcgacaacgacctcggtgccaccgactacaccttcggcttc
gataccgcggtgcacgtggccaccgaggccatcgaccggctccgcaccaccggcgacagc
caccaccggtgcatggtcctggaggtgatgggccgccacgcagggtggatcgccctgcac
gcgggcatcgccggtggcgcccacgcggtgctcatccccgaggtcgccgtcggctacgac
caggtggcgcagtgggtgcgggcgaccgccgaccgcgggcgggccccgatggtggtggtc
gccgagggcttcatgcccgacggcgagctcgtctccggcggtcaggtggacggcatgggc
cgcccgcgcctcggcggggtgggggagcaggtggcacgggagatcgaggagcgcaccggc
atcgagtcgcgcgccatggcgctgggccacatgcagcgcgggggctcacccaccgcctat
gaccgggtgctggccacgcgcttcggtaccgcggccctcgatgcggtgcacgaccgtgcc
ttcggccagatggtggccctggcgggcaccgagatcgtgcgcgttccgctggccgaggcg
accacggcgctcaagagcgtcccgcgggagcggtgggacgaggcggccatcctgttcggg
tga

DBGET integrated database retrieval system