KEGG   Kytococcus sedentarius: Ksed_16120Help
Entry
Ksed_16120        CDS       T00974                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kse  Kytococcus sedentarius
Pathway
kse00010  Glycolysis / Gluconeogenesis
kse00052  Galactose metabolism
kse00500  Starch and sucrose metabolism
kse00520  Amino sugar and nucleotide sugar metabolism
kse00521  Streptomycin biosynthesis
kse01100  Metabolic pathways
kse01110  Biosynthesis of secondary metabolites
kse01120  Microbial metabolism in diverse environments
kse01130  Biosynthesis of antibiotics
kse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ksed_16120
   00052 Galactose metabolism
    Ksed_16120
   00500 Starch and sucrose metabolism
    Ksed_16120
   00520 Amino sugar and nucleotide sugar metabolism
    Ksed_16120
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ksed_16120
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ksed_16120
Enzymes [BR:kse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ksed_16120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACV06627
UniProt: C7NIC0
Position
complement(1658821..1659783)
Genome map
AA seq 320 aa AA seqDB search
MSLAIGVDIGGTKIAGALVRDGEILQRARVETPAEDVGAIVEAVTTVIQDLQGKAGGEDV
VGAGIACAGLVDAAGETILFAPNLAWRDEPLKAKVAAQVDLPIRLENDANAAAWGEFRHG
AARDHDDMTLITVGTGIGGGIVNDGTLLRGAAGVGAEIGHMRVVRDGLRCGCGNRGCWEQ
YGSGSALVREARDLIRSGTPHAARLSGACGGDPDALEGADVTKVAEEGDPAAAELIHELG
VWIGEGAASLAAILDPAAIVIGGGVSAAGDLLLEPARRAFHRNLTGRGYRPWPEMVMASL
GNDAGVIGAASIMLDERPTS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgccatcggtgtcgacatcggaggcaccaagatcgctggggccctggtccgg
gacggcgagatcctccagcgggcgcgggtcgagacccccgccgaggacgtcggagccatc
gtcgaggccgtgaccacggtcatccaggacctccagggcaaggcggggggcgaggacgtc
gtgggtgccggcatcgcgtgtgcaggcctggtggacgccgcgggcgagaccatcctgttc
gccccgaacctggcgtggcgggacgagcccctcaaggcgaaggtggccgcccaggtcgac
ctgccgatccggctggagaacgacgccaacgcggcagcctggggggagttccgccacgga
gctgcccgggaccacgacgacatgaccctcatcaccgtcgggaccggcatcggcggcggc
atcgtcaacgatggcaccctcctgcgaggcgctgccggagtgggcgccgagatcggccac
atgcgcgtggtgcgcgacggcctgcgctgcgggtgcggcaaccgcggctgctgggagcag
tacggctcgggcagcgccctggtccgcgaggcccgcgacctcatccggtccggtaccccc
cacgcagctcgcctcagcggcgcctgcgggggcgatcccgacgcgctcgagggggccgac
gtcacgaaggtggccgaggagggcgaccccgcggcggcggagctcatccacgagctgggg
gtctggatcggcgagggcgcagccagcctcgcggcgatcctcgacccggcggcgatcgtc
atcggcggcggggtgagtgctgccggcgacctgctgctcgagcccgctcgccgggccttc
caccgcaatctcaccggtcgcggttaccgcccgtggccggagatggtgatggcgagcctg
ggcaacgacgcgggcgtcatcggcgcggcctcgatcatgctcgacgagcggcccacgagc
tga

DBGET integrated database retrieval system