KEGG   Kitasatospora setae: KSE_00090tHelp
Entry
KSE_00090t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HA ResIII DEAD Helicase_C AAA_30 Flavi_DEAD
Motif
Other DBs
NCBI-ProteinID: BAJ25862
NITE: KSE_00090t
UniProt: E4MYW9
Position
complement(13584..17138)
Genome map
AA seq 1184 aa AA seqDB search
MSREPRSLREHQQQAIEAATATLGLLPRATVIAACGTGKTLIAIRVAEHFAGQGNVLVLM
PTLDLVAQTIRRWREDSSIHRMTAVCSSGRTDYPDITRHVVFTTDPEVLASRLSERPGPA
VVFATYASLEVLELAHRRHFLPEWAIVVADEAHHTSGDRGKDWGAVHDDERLPAARRLYM
TATPRLWTANSGTRRRKRKPGAPVELASMNDATIYGPVVYRLTLAQAIDRKLLADYRIVV
PIIRDEDLREVLHTAEATPEYDGLRLAALQVGLLQAVADYGLRRVVTFHSRIVASQNFAD
SLPLTAAAISEQDTPPRIWSRAVHSNQTPRQRARCLRQFDTMPLLGSTTRGPLGYQFAIL
ANVKTLGEGVDVPDADGVLFADPKRSAVDIVQSLGRALRQPPGSGKIATLVIPVYLAPGQ
STREAMWSSHFSVLWDVLTGLRDHDDRVFHRLTGIRRRRLQDPVLPGPERADEIAPVLDL
RTHQIDSGEWADGWNAAVRFVDRHDHFDVPSDYTDSSGFPLGCWVGRHRTHYKAGTLPIE
RAVALNALGISWPHPPDSFEHHLERAAATASRTGSLAFDPTIPGSDPTLGAWLARMRRRA
STSNLESERVDALNAVDPWWNPPWSLRWQHTYTHLRHRLATTTWTIPYHRQADTDTGWNS
WLDRQINRRDDLHPGQRHLLHHLARTHPDAHPHTILLSRPATALAAAFTRGLRAARQYHQ
REGHLDVPAGHCETVDSEQVHLGRWIRQRQRDAAQLTSRQLTALRALGIDPAPHFLQAPA
DPALTQPAGPIEPPGPPLAAPRIPQPFPHRARSEPADTTAGSSTAPPGTDTAPHHQATAP
PAAAVIAQAAPRPTAFEEPWASMLTKAATFAAQHGHLNPAEGALASWLSRQRHLHATGRL
ATRRRNDLDALGMIWNKHEDAWERGYAHARAFAVRTGHLAVPADEQVEDYNLGTWVRRQR
KADLTADQEARLTALDPLWRMAPDWQRSYRRLVAYLAAGGRLTGPVNRTGTPGDERFRPG
AWLRMQNRHADTGNLDAHQTALLDALGAWRTHPAQGEPAPYRRAQGSAGCGQPPYARSMA
APPSVPPLRPGPRTDRPAHRPPRSALTPIHQLPAEFRRYIKAARAFRDREGHLDVPPGFV
ERVEHAKVRLGTWIARQRDKVFRGQLPPLLISELEALDMVWVRR
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagggaaccgcgctcactgcgtgaacaccagcagcaggcgatcgaggccgcgacg
gcgacgctgggactcctgccgagagcgacggtgatcgcagcgtgcggcaccggcaagacc
ctgattgcgatccgggtcgccgagcacttcgccgggcagggcaacgtcctggtgctcatg
cccaccctggacctggtcgcccagaccatccgccgatggcgcgaggacagcagcattcac
cgcatgaccgctgtgtgctccagcggccgcaccgactatccggacatcacccggcatgtc
gtcttcaccaccgaccccgaagtcctcgcctcccggctctccgagcgccccgggccggcc
gtggtcttcgccacctacgcttccctggaagtgctcgaactcgcccaccgtcggcacttc
ctgcccgaatgggcgatcgtcgtcgccgacgaagcgcaccacaccagcggcgaccgcggc
aaggactggggagcggtccacgacgacgagcgcctgcccgctgcccggcgcctctacatg
accgccaccccgcgcctgtggacggcgaacagcggcacacgcagacgcaagcgcaagccc
ggggccccggtcgaactcgcgtccatgaacgacgccaccatctacgggcccgtggtctac
cgcctcaccctggcacaggccatcgaccgcaaactgctggccgactaccgcatcgtcgtg
cccatcatccgcgacgaagacctgcgcgaggtcctccacaccgccgaagcaacccccgag
tacgacggactgcggctggccgccctgcaggtgggcctcctgcaagccgtcgccgactac
ggactgcgccgcgtggtcaccttccacagccgcatcgttgcctcccagaacttcgccgac
agcctccccctcaccgccgccgccatcagcgaacaggacaccccgccgcgcatctggtcc
agggccgtccacagcaaccagaccccgcgacaacgcgcccggtgcctacgtcagttcgac
accatgcccctgctgggcagcacgacccgagggccgctgggctaccagttcgccatcctg
gccaacgtcaagaccctcggggagggcgtcgacgtccccgacgccgacggcgtcctgttc
gccgaccccaaacgcagcgccgtcgacatcgtccagtccctcgggcgcgccctgcgccag
cccccgggctccggcaagatcgccacgctggtcatcccggtctacctcgcccccggccag
tccacccgggaggccatgtggtcctcccacttctccgtcctgtgggacgtcctcaccgga
cttcgcgaccacgacgaccgcgtcttccaccgcctcacgggcatccgccgccgccgcctc
caagaccctgtcctccccggtcctgaacgcgccgacgagatcgcccccgtcctcgacctg
cgcacccaccagatcgacagcggtgaatgggcggacggctggaacgcggcggtgcgcttc
gtcgaccggcacgaccacttcgacgtgcccagcgactacaccgactcgtcaggatttccc
ctcggctgctgggtcggccgtcaccgcacccactacaaggccgggacactgcccatcgaa
cgggcggtcgcgctcaatgccctcggcatctcctggccccacccaccggacagcttcgag
caccacctggaacgggccgccgcgaccgcctcccgcaccggaagcctcgccttcgacccg
acgatccccggcagcgaccccacgctcggcgcctggctcgcccgcatgcgccgacgagcg
agcaccagcaacctggagtccgaacgggtcgacgccctcaacgccgtcgacccgtggtgg
aaccccccatggagcttgcgctggcagcacacctacacccacctacgtcaccgactcgcg
accaccacctggacgatcccctaccaccggcaggccgacaccgacaccggctggaacagc
tggctcgaccgccagatcaaccgccgggacgacctccacccggggcagcggcatctcctg
caccacctcgcccgcacccaccccgacgcccacccccacacgatcctcctgtcccgcccc
gccaccgcactcgccgcagccttcacccgcggactgcgtgccgcccgccagtaccaccag
cgcgaaggccacctggatgtgcccgccggccactgcgagaccgtcgactccgagcaggtc
cacctcggacgatggatccgccagcgccaacgcgacgcagcccaactgaccagccggcag
ctcaccgccctgcgggccctcggcatcgacccggccccgcacttcctccaagcccccgcc
gaccccgccctcactcaaccggccggccccatagaaccgcccggccccccgctggccgcc
ccccggatcccgcagccgttcccgcaccgcgcccgatcggagccagccgacaccacggcc
ggaagcagcacggcgccgccaggcacagacacagccccccaccaccaggccacagcccca
ccagccgctgccgtcatcgcgcaggccgcgcccaggccgacagcattcgaggagccgtgg
gccagcatgctcaccaaggccgcgaccttcgccgcacagcacggccacctcaaccctgcc
gaaggcgccctcgcgagctggctctcccggcagcgccacctgcacgccaccggccgactc
gccaccagacgccgaaacgacctggacgccctcgggatgatctggaacaagcacgaggac
gcctgggagcgcggctacgcccacgcgcgcgcgtttgccgtgcgcactggccatctggcc
gttcccgccgacgagcaggtcgaggactacaacctcggcacgtgggtgcgtcgccagcga
aaggccgacctgaccgcggatcaggaagcacggctcaccgcactggacccgctctggcgg
atggcgccggactggcagcgctcataccgtcgcctcgtcgcctacctggcagccggcggc
cgcctcaccggtcccgtgaaccgcaccgggacacccggcgacgaacgcttccggccgggt
gcgtggctgcgcatgcagaaccgacacgccgacaccggcaacctcgacgcgcaccagacc
gcgctcctggacgccctcggagcctggcgaacccaccccgcacagggcgagcccgcgccg
taccgcagggcgcagggcagtgccggctgcgggcagcccccatacgcccggtcgatggcc
gcaccaccatcagtgccgcccctacggcccggaccccgaacggaccggccagcccatcgg
ccgccgcggtccgccctcaccccgatccaccaactgccagcggaattccgtcgctacatc
aaagctgcgcgagccttccgggaccgggagggccacctggacgtcccgcccggattcgtc
gagcgcgtcgagcacgccaaggtccgcctcggcacctggatcgcccgccaacgcgacaag
gtcttccgagggcaactcccgccgctcctgatctcagaactggaagccctggacatggtg
tgggtgcgcagatga

DBGET integrated database retrieval system