KEGG   Kitasatospora setae: KSE_00160tHelp
Entry
KSE_00160t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_15
Motif
Other DBs
NCBI-ProteinID: BAJ25869
NITE: KSE_00160t
UniProt: E4MYX6
Position
28985..29272
Genome map
AA seq 95 aa AA seqDB search
MDRVEVRVVVPGEAGRRLAALAAGLGWSAERVLAVLAEHAQVDDDGLVHVPPVAVTAAPP
GLEPPPERAPVVYRERPRFGRDEGGEGYGGPALDW
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgggtggaggtgcgcgtggtggtgccgggtgaggcggggcgccgcctggcggcg
ttggccgcggggttggggtggagcgcggagcgggtgctggcggtgctcgccgagcacgcc
caggtcgacgacgacggcctggtccacgttcccccggtcgcggtcacggcggcgccgccc
ggcctggagccgcccccggagcgggcgccggtggtctaccgggagcggccgcggttcggg
cgcgacgagggcggcgagggctacggcggcccggcgctggactggtag

DBGET integrated database retrieval system