KEGG   Kitasatospora setae: KSE_10730Help
Entry
KSE_10730         CDS       T01648                                 

Definition
(GenBank) putative amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
ksk  Kitasatospora setae
Pathway
ksk00330  Arginine and proline metabolism
ksk00360  Phenylalanine metabolism
ksk00380  Tryptophan metabolism
ksk00627  Aminobenzoate degradation
ksk00643  Styrene degradation
ksk01100  Metabolic pathways
ksk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    KSE_10730
   00360 Phenylalanine metabolism
    KSE_10730
   00380 Tryptophan metabolism
    KSE_10730
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KSE_10730
   00643 Styrene degradation
    KSE_10730
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     KSE_10730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAJ26907
NITE: KSE_10730
UniProt: E4N6S6
Position
1190440..1191957
Genome map
AA seq 505 aa AA seqDB search
MERWTYPTAGELASALRAGDVTSTELTEQAIERIEQADGALNAVCAPDFERARAAAREAD
LALARGAHGRGGEGGARGELGRRRPLLGVPVTVKESFDAVGLPTTWGNPEFRGHLAAEDA
LLVERMRAAGAVVLGKTNVPLGLRDIQTYNEIHGTTNNPWDLARTPGGSSGGSAAALAAG
FGALSLGSDIGGSLRTPAHFCGVHAHKPTLHLLPTRGMSPPPGPALPTDIELAVAGPMAR
SAGDLTLLLDVLLGPDPLTRGRSDTTALPPARHQRLDGFRVLVLDEHPLLPTGADVRAGI
ARTADALADGGARVVRHSPLLPDLAEAAELYMLLLFAISTARFPAAAYEQVRSLAAELGA
DDRSLHAARLRGATLSHRDWLAADHRRELHRRSWRRLFTEFDAVVAPITPTAAFPHHQDP
DLLNRRITIAGTDHRYLDQLVWAGLATMPGLPATAVPTGPSTEGLPVGVQLIGPMYEDRT
PLRLAELLEEHLGGFRPPPPRPADR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagcgatggacctatccgacggccggggaactggcatcggcgctgcgcgccggggac
gtcacctcgacggagctgaccgagcaggcgatcgagcggatcgagcaggcggacggggcg
ctgaacgcggtctgcgcaccggacttcgagcgggccagggcggccgcgcgggaggccgac
ctggcgctggcgcgcggggcgcacggcagaggcggggaaggcggggcgcgcggcgaactc
ggccggcggcggccgctgttgggggttccggtcacggtgaaggagtcgttcgacgccgtg
gggctgcccaccacctgggggaacccggagttccgcgggcacctggcggcggaggacgcg
ctgctggtggagcggatgcgagcggcgggcgcggtggtgctgggcaagaccaacgtgccg
ctcgggctgcgggacatccagacgtacaacgagatccacggcaccaccaacaacccgtgg
gacctcgcccgcaccccgggcggctcctccggcggttcggcggcggcgctggccgccggg
ttcggggcactctcgctgggctcggacatcggcggctcgctgcgcacccccgcgcacttc
tgcggcgtccacgcgcacaagccgaccctgcacctgctgcccacccgcggcatgagcccg
ccgcccggacccgcgctgccgaccgacatcgaactcgccgtggccggcccgatggcccgt
tcggccggcgacctgacgctgctgctcgacgtgctgctcggccccgacccgctgacccgc
ggccggtcggacaccaccgcactgccgcccgcccggcaccaacggctggacggcttccgg
gtgttggtgctggacgagcacccgctgctgccgaccggcgccgacgtccgcgcgggcatc
gcccggaccgccgacgcgctcgccgacggcggggcccgggtcgtccggcacagcccgctg
ctgcccgacctcgccgaggccgccgaactctacatgctgctgctgttcgccatctccacc
gcccgcttccccgccgccgcgtacgagcaggtacgcagcctggcagccgagttgggcgcg
gacgaccgcagcctgcacgccgcgcggctgcgcggcgcgacgctctcccaccgcgactgg
ctggccgccgaccaccggcgcgaactccaccggcggtcctggcgacggctgttcaccgag
ttcgacgccgtcgtcgcgccgatcaccccgaccgccgccttcccgcaccaccaggacccg
gacctgctgaaccgccggatcaccatcgccggcaccgaccaccgctacctcgaccaactg
gtctgggccggcctcgccaccatgccgggcctccccgccaccgccgtccccaccggcccg
tccaccgagggcctcccggtcggcgtccagctgatcggcccgatgtacgaggaccgcacc
ccgctccgcctcgccgaactcctggaggaacacctcggcggcttccgcccgccgccaccg
cgcccggccgaccgctga

DBGET integrated database retrieval system