KEGG   Kitasatospora setae: KSE_17040Help
Entry
KSE_17040         CDS       T01648                                 

Definition
(GenBank) putative L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ksk  Kitasatospora setae
Pathway
ksk00260  Glycine, serine and threonine metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_17040
Enzymes [BR:ksk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KSE_17040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Transket_pyr
Motif
Other DBs
NCBI-ProteinID: BAJ27528
NITE: KSE_17040
UniProt: E4N8J7
Position
complement(1894356..1895450)
Genome map
AA seq 364 aa AA seqDB search
MTPAASPSLGTTDAVRHHDPAVRGFASDNYAGVHPEVLAAIALANDGHQVSYGEDAYTEH
LQTVFRRHFGDRAEAYPVFNGTGANVVALQALLPRWGAVVAAESAHINVDECGAPEKLAG
IKIHTVPTPDGKLTPALIDQQAWGWGDEHRAQPLAVSITQSTELGTLYTVDEVRAICEHA
HERGMLVHMDGSRLANAAASLGVPFREFTTDAGVDVLSFGGTKNGLLLGEVVVVLDPERV
SNLKYLRKMSMQLASKMRFVSVQFEALLTGDLWLRNAGHANAMARRLEAAVRDIPGVTVV
RPVQANAVFALLPREVSERLQKRYRFYFWDEHTGEVRWMAAFDTTEQDIDAFAAAITEEM
ARQL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgccgcctccccttccctcggtacgaccgacgcggtccggcaccacgacccc
gccgtccgcggcttcgccagcgacaactacgccggcgtccaccccgaggtgctcgccgcg
atcgccctcgccaacgacggccaccaggtctcctacggcgaggacgcctacaccgagcac
ctgcagacggtcttccgccgccacttcggcgaccgcgccgaggcgtaccccgtcttcaac
ggcaccggcgccaacgtcgtcgccctccaggcgctgctcccgcgctggggcgcggtcgtc
gccgccgagagcgcccacatcaacgtcgacgagtgcggcgcccccgagaagctcgccggc
atcaagatccacaccgtccccacccccgacggcaagctcacccccgccctgatcgaccag
caggcctggggctggggcgacgagcaccgcgcccagccgctcgccgtctcgatcacccag
tccaccgaactcggcaccctctacacggtcgacgaggtccgggcgatctgcgagcacgcc
cacgaacgcggcatgctcgtccacatggacggctcccggctcgccaacgccgccgcctcg
ctcggcgtcccgttccgcgagttcaccacggacgccggcgtcgacgtcctctccttcggc
ggcaccaagaacggcctgctgctcggcgaggtcgtcgtcgtgctcgaccccgagcgggtc
agcaacctcaagtacctccgcaagatgtcgatgcagctcgcctcgaagatgcgcttcgtc
tccgtccagttcgaagccctcctcaccggcgacctctggctccgcaacgccggccacgcc
aacgcgatggcccgccgcctcgaagccgccgtccgcgacatccccggcgtcaccgtcgtc
cgccccgtccaggccaacgccgtcttcgccctcctcccgcgcgaggtcagcgagcgcctg
cagaagcgctaccgcttctacttctgggacgagcacaccggcgaggtccgctggatggcc
gccttcgacaccaccgaacaggacatcgacgccttcgccgccgcgatcaccgaggagatg
gcccgccagctctga

DBGET integrated database retrieval system