KEGG   Kitasatospora setae: KSE_20490Help
Entry
KSE_20490         CDS       T01648                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ksk  Kitasatospora setae
Pathway
ksk00260  Glycine, serine and threonine metabolism
ksk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01130  Biosynthesis of antibiotics
ksk01230  Biosynthesis of amino acids
Module
ksk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KSE_20490 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KSE_20490 (trpA)
Enzymes [BR:ksk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KSE_20490 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth KDGP_aldolase BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: BAJ27872
NITE: KSE_20490
UniProt: E4N9J1
Position
complement(2285172..2285981)
Genome map
AA seq 269 aa AA seqDB search
MADTKLTTTLAATKAAGRAALIGYLPAGFPTVDGGTAAIKALIEGGCDVVEVGLPHSDPV
LDGAVIQTADDIALRGGVKIKDVLATVAEVAAAHPAVPVLVMTYWNPVDRYGVARFAADL
AAAGGAGCILPDLPYEESVEWRKAAEEHGLDTVFVVAPSSTDHRLAEVTAAGSGFVYAAA
VMGVTGTRAAVGNLAEDLVARTRATTSLPVCVGLGVSDADQAAEVAGFADGVIVGSAFVK
RLLEADEPAAGLAAVRALAAELAEGVRRK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaccaagctcaccaccaccctggccgccaccaaggcggcgggccgggcggcc
ctgatcggctacctgccggccggcttcccgaccgtggacggcggcaccgccgcgatcaag
gccctgatcgagggcggctgcgacgtggtcgaggtcggcctgccgcactccgacccggtg
ctggacggcgcggtcatccagaccgcggacgacatcgcgctgcgcggcggcgtgaagatc
aaggacgtgctggccaccgtcgccgaggtggcggcggcccacccggccgtcccggtcctg
gtgatgacgtactggaacccggtcgaccgctacggggtggcccggttcgccgccgacctg
gcggcggccggcggcgcgggctgcatcctgcccgacctgccgtacgaggagtcggtggag
tggcgcaaggccgccgaggagcacggtctggacaccgtgttcgtggtcgccccgtcctcg
accgaccaccggctggccgaggtcaccgcggcgggctccggcttcgtctacgcggcggcc
gtgatgggcgtcaccggcacccgcgccgcggtcggcaacctggccgaggacctggtggcc
cgcacccgcgccaccacctcgctgccggtctgcgtcggcctgggcgtctccgacgccgac
caggccgccgaggtggccggcttcgcggacggcgtgatcgtcggctcggcgttcgtcaag
cgcctgctggaggccgacgagccggcggccggcctggccgccgtccgggcgctcgcggcc
gagctggcggagggcgtccgccgcaagtag

DBGET integrated database retrieval system