KEGG   Kitasatospora setae: KSE_21100Help
Entry
KSE_21100         CDS       T01648                                 

Gene name
rluD
Definition
(GenBank) putative ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ksk  Kitasatospora setae
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ksk03009]
    KSE_21100 (rluD)
Enzymes [BR:ksk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     KSE_21100 (rluD)
Ribosome biogenesis [BR:ksk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    KSE_21100 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: BAJ27933
NITE: KSE_21100
UniProt: E4N9Q2
Position
complement(2346491..2347429)
Genome map
AA seq 312 aa AA seqDB search
MSIAAQTRSLPVPDGLEGERLDAALARMFGFSRTKAAELAAEGKVTLDGAVAGKSDRVTA
GSWLEVEIPAPAAPVQIVAEAVEGMRIIHDDDHVVVIDKPVGVAAHPSPGWTGPTVIGGL
AAAGYRISTSGAAERQGVVHRLDVGTSGIMVVAKSERAYTDLKRQFHDRVTEKKYNALVQ
GHPDPLSGTVDAPIGRHPSSDWKWAVTRDGKPSVTHYDLIEAYRAASLLDIKLETGRTHQ
IRVHMSALRHPCVGDLTYGADPTLAKRLGLTRQWLHAVSLGFEHPEDGRWVEFSSDYPED
LQHALDTIAAES
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatcgcagcgcagacccgtagcctccccgtacccgacggcctggagggcgagcgg
ctggacgccgccctggcccggatgttcgggttctcccgcaccaaggccgccgaactcgcc
gccgagggcaaggtgaccctggacggcgcggtcgccgggaagtcggaccgggtcaccgct
ggctcctggctggaggtcgagatccccgcccccgcggcgccggtgcagatcgtcgccgag
gccgtcgagggcatgcggatcatccacgacgacgaccacgtcgtggtgatcgacaagccg
gtcggcgtggccgcgcaccccagccccggctggaccggccccaccgtgatcggcggcctg
gccgcggccggctaccggatctccacctccggcgccgccgagcgccagggcgtcgtgcac
cgcctcgacgtcggcacctccgggatcatggtggtcgccaagtccgagcgggcctacacc
gacctgaagcgccagttccacgaccgggtcaccgagaagaagtacaacgcgctggtccag
ggccaccccgacccgctgtccggcaccgtggacgcgccgatcggccgccaccccagcagc
gactggaagtgggccgtcacccgcgacggcaagccctccgtcacgcactacgacctgatc
gaggcgtaccgggccgcgtcgctgctcgacatcaagctggagaccggccgcacccaccag
atccgggtgcacatgtccgcgctgcgccacccctgcgtcggcgacctcacctacggcgcg
gacccgacgctggccaagcggctcggcctgacccggcagtggctgcacgccgtctcgctc
ggcttcgagcaccccgaggacgggcgctgggtcgagttcagctccgactaccccgaggac
ctgcagcacgcgctggacaccatcgcggcggagagctga

DBGET integrated database retrieval system