KEGG   Kitasatospora setae: KSE_51540Help
Entry
KSE_51540         CDS       T01648                                 

Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ksk  Kitasatospora setae
Pathway
ksk00010  Glycolysis / Gluconeogenesis
ksk00030  Pentose phosphate pathway
ksk00051  Fructose and mannose metabolism
ksk00052  Galactose metabolism
ksk00680  Methane metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_51540
   00030 Pentose phosphate pathway
    KSE_51540
   00051 Fructose and mannose metabolism
    KSE_51540
   00052 Galactose metabolism
    KSE_51540
  Energy metabolism
   00680 Methane metabolism
    KSE_51540
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KSE_51540
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     KSE_51540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK AIRC NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAJ30933
NITE: KSE_51540
UniProt: E4NHF3
Position
5727782..5728807
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRGTDVHGDEILGIEDGFLGLIEGRARPLSHDDVTGL
LTLGGTILGSARVQRDKIRWAVENSRQLAANLGIDALIAIGGEGTLTAAKLFSDAGLPVV
GVPKTIDNDIDATDVTFGFDTAVHVATEAIDRLKTTAESHQRVMVVELMGRHTGWITLTA
GMAGGAHGILIPEKPFDIEAVARMIEERFQRGKKFAIIAVAEGAQPLPGTLRFEHGQVDQ
FGHQTFGGIGTRLAIELENLLGKEARPVILGHTQRGGTPTALDRVLATRFGWHAVEAVHK
GAFGHFTALRGTEIHLTPIADAVVQLKTVPEDRWSESEAVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggcgtcctcaccagcggcggcgactgccccggcctcaacgcggtgatccgc
tcggtcgtgcaccgcggcaccgacgtgcacggcgacgagatcctcggcatcgaggacggc
ttcctcggcctgatcgagggccgcgcccgcccgctctcgcacgacgacgtcaccggcctg
ctcaccctcggcggcaccatcctcggctccgcccgggtgcagcgcgacaagatccgctgg
gcggtcgagaactcccggcagctcgccgcgaacctcggcatcgacgcgctgatcgcgatc
ggcggcgagggcaccctgaccgccgccaagctgttcagcgacgccggactgcccgtcgtc
ggcgtccccaagaccatcgacaacgacatcgacgccaccgacgtcaccttcggcttcgac
accgccgtgcacgtcgccaccgaggccatcgaccggctgaagaccaccgccgagtcgcac
cagcgggtcatggtggtcgagctgatgggccggcacaccggctggatcaccctcaccgcg
ggcatggccggcggcgcccacggcatcctgatcccggagaagcccttcgacatcgaggcc
gtcgcccggatgatcgaggagcgcttccagcgcggcaagaagttcgccatcatcgcggtc
gccgagggcgcccagccgctgcccggcacgctgcgcttcgagcacggccaggtcgaccag
ttcggtcaccagaccttcggcgggatcggcacccggctcgccatcgagctggagaacctg
ctcggcaaggaggcccggccggtcatcctcggccacacccagcgcggcggcacccccacc
gcgctcgaccgggtgctcgccacccgcttcggctggcacgccgtcgaggccgtccacaag
ggcgcgttcgggcacttcaccgcgctgcgcggcaccgagatccacctcaccccgatcgcc
gacgccgtggtccagctcaagaccgtcccggaggaccgctggagcgagtccgaggccgtg
ctctga

DBGET integrated database retrieval system