KEGG   Kitasatospora setae: KSE_55470Help
Entry
KSE_55470         CDS       T01648                                 

Gene name
zwf
Definition
(GenBank) putative glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ksk  Kitasatospora setae
Pathway
ksk00030  Pentose phosphate pathway
ksk00480  Glutathione metabolism
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
Module
ksk_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ksk_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KSE_55470 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KSE_55470 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ksk04147]
    KSE_55470 (zwf)
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     KSE_55470 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     KSE_55470 (zwf)
Exosome [BR:ksk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KSE_55470 (zwf)
  Exosomal proteins of colorectal cancer cells
   KSE_55470 (zwf)
  Exosomal proteins of bladder cancer cells
   KSE_55470 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAJ31322
NITE: KSE_55470
UniProt: E4MZZ4
Position
complement(6211658..6213196)
Genome map
AA seq 512 aa AA seqDB search
MGDTQERPVNPLRDPADRRLPRIAGPSGLVIFGVTGDLSRKKLMPAIYDLANRGLLPPGF
SLVGFARREWEDEDFANEVHDAVKEHARTPFREEVWQQLAKGMRFVQGDFGDDEAFDTLR
RTIEDLDQAQGTGGNFAFYLSVPPKFFPTVVQQLKKHGLTDPPQGSWRRAVIEKPFGHDL
ASAQELNRIVHEVFPRDEVFRIDHYLGKETVQNILALRFANQMFEPIWNRSYVDHVQITM
AEDIGIGGRAGYYDGIGSARDVIQNHLLQLMALTAIEEPASFHPKALVAEKLKVLSAVKL
PADLGAHTVRGQYAAGWQGGEEVVGYLDEDGINPESGTDTYAAIKLEINNRRWAGVPFYL
RTGKRLGRRVTEIAVVFQRAPYLPFDSYATEELGQNALVIRVQPDEGVTVRFGSKVPGTA
LEVRDVTMDFAYGESFTESSPEAYERLILDVLLGDANLFPRHQEVELSWQILDPIEQYWD
SHGKPAQYPAGTWGPVEADEMLARDGRSWRRP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgacacccaggaacggcccgtcaacccgctgcgcgaccccgccgaccggcggctg
ccgaggatcgccgggccgtccggcctggtgatcttcggcgtcaccggcgacctgtcgcgc
aagaagctgatgccggcgatctacgacctcgccaaccgcggcctgctgccgccgggcttc
tcgctggtcgggttcgcccgccgcgagtgggaggacgaggacttcgccaacgaggtccac
gacgccgtcaaggagcacgcccgcacgcccttccgcgaggaggtctggcagcagctggcc
aagggcatgcgcttcgtccagggcgacttcggcgacgacgaggccttcgacaccctgcgc
cgcaccatcgaggacctcgaccaggcgcagggcaccggcggcaacttcgcgttctacctg
tcggtgccgccgaagttcttcccgaccgtggtccagcagctcaagaagcacggcctgacc
gacccgccgcagggctcctggcgccgcgcggtgatcgagaagccgttcggccacgacctg
gccagcgcccaggagttgaaccggatcgtccacgaggtcttcccgcgcgacgaggtcttc
cggatcgaccactacctgggcaaggagaccgtccagaacatcctggcgctgcgcttcgcc
aaccagatgttcgagccgatctggaaccggtcgtacgtcgaccacgtgcagatcaccatg
gccgaggacatcggcatcggcggccgggccggctactacgacggcatcggctccgcccgc
gacgtcatccagaaccacctgctccagctgatggcgctgaccgccatcgaggagccggcg
tccttccacccgaaggcgctggtcgccgagaagctgaaggtgctcagcgccgtcaagctc
cccgccgacctgggcgcgcacaccgtgcgcggccagtacgcggccggctggcagggcggc
gaggaggtcgtcggctacctggacgaggacggcatcaaccccgagtccgggaccgacacc
tacgccgcgatcaagctggagatcaacaaccggcgctgggcgggcgtcccgttctacctc
cgcaccggcaagcggctgggccgccgggtcaccgagatcgcggtggtcttccagcgcgcc
ccgtacctgccgttcgactcctacgccaccgaggagctcggccagaacgccctggtgatc
cgcgtccagccggacgagggcgtcaccgtgcggttcggctcgaaggtccccggcaccgcg
ctggaggtccgcgacgtcacgatggacttcgcctacggcgagtccttcaccgagtccagc
cccgaggcgtacgagcgcctcatcctggacgtgctgctcggcgacgcgaacctcttcccg
cggcaccaggaggtcgagctgtcctggcagatcctcgacccgatcgagcagtactgggac
agccacggcaagcccgcgcagtacccggccggcacctggggcccggtcgaggcggacgag
atgctcgcacgagacggcaggagctggcgccgcccatga

DBGET integrated database retrieval system