KEGG   Kitasatospora setae: KSE_63960Help
Entry
KSE_63960         CDS       T01648                                 

Gene name
glk2
Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ksk  Kitasatospora setae
Pathway
ksk00010  Glycolysis / Gluconeogenesis
ksk00052  Galactose metabolism
ksk00500  Starch and sucrose metabolism
ksk00520  Amino sugar and nucleotide sugar metabolism
ksk00521  Streptomycin biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01120  Microbial metabolism in diverse environments
ksk01130  Biosynthesis of antibiotics
ksk01200  Carbon metabolism
Module
ksk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KSE_63960 (glk2)
   00052 Galactose metabolism
    KSE_63960 (glk2)
   00500 Starch and sucrose metabolism
    KSE_63960 (glk2)
   00520 Amino sugar and nucleotide sugar metabolism
    KSE_63960 (glk2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KSE_63960 (glk2)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KSE_63960 (glk2)
Enzymes [BR:ksk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KSE_63960 (glk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAJ32155
NITE: KSE_63960
UniProt: E4N1X1
Position
7177431..7178540
Genome map
AA seq 369 aa AA seqDB search
MTRADRPARPPRPALPNLLGLGPRAERRRRTLPAGVLRLPTVGVDIGGTKVVAGVVDGDG
NVVDRLRTETPDKSKSPRVVEDVIVDLVLELADKHDVHAVGVGAAGWVDAERSTVLFAPH
LNWRGEPLREALSARLRFPVVVENDANAAAWAEWRFGAGRGEDHMVMITLGTGIGGAVVR
DGRVDRGKHGLAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARGLAAEESPVVQ
PLLARAGGTPLGITGPLVTEAARDGDPVAVELLYEVGRWLGVGIANLAAALDPGRFVIGG
GVSEAGDLLIGPARDAFGRTLTGRGFRPEADLVPAALGNEAGLVGAADLARQLARRFRTV
KRRRIGRDA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgccgaccgccccgcccgcccgccccgccccgccctgccgaacctgctgggc
ctcggcccgcgcgccgagcgccgccgccgcacgctgcccgccggagtgctgcggctcccc
accgtcggggtcgacatcggcggcaccaaggtggtcgcgggcgtggtcgacggcgacggc
aacgtggtggaccggctgcgcaccgagacccccgacaagagcaagagcccccgggtggtc
gaggacgtcatcgtcgacctcgtgctggaactcgccgacaagcacgacgtgcacgccgtc
ggcgtcggcgcggccggctgggtcgacgccgagcgctccaccgtgctgttcgccccgcac
ctgaactggcgcggcgaaccgctgcgggaggcgctcagcgcccggctgcggttccccgtc
gtggtggagaacgacgccaacgcggccgcctgggcggagtggcggttcggcgccgggcgc
ggcgaggaccacatggtgatgatcaccctcggcaccgggatcggcggcgccgtcgtccgg
gacggccgcgtcgaccggggcaagcacggcctggccggcgagttcggccacatgcaggtg
gtgcccggcggccaccgctgcccgtgcggcaaccggggctgctgggagcagtactcgtcc
ggcaacgcgctggtccgggaggcccgcggcctggccgccgaggagtccccggtggtccag
ccgctgctggcccgggccggcggcaccccgctgggcatcaccgggccgctggtcaccgag
gccgcccgggacggcgacccggtcgccgtcgaactgctctacgaggtcggccgctggctg
ggcgtcggcatcgccaacctcgccgccgcgctcgaccccggacgcttcgtcatcggaggc
ggcgtcagcgaggccggcgacctgctgatcggccccgcccgcgacgccttcggccgcacc
ctcaccggccgcggcttccgccccgaggccgacctcgtgcccgccgccctcggcaacgag
gccggcctggtcggcgccgcggacctggcccgccagctcgcccgccgcttccgcaccgtc
aagcgccgccggatcggacgcgacgcctga

DBGET integrated database retrieval system