KEGG   Kitasatospora setae: KSE_74220Help
Entry
KSE_74220         CDS       T01648                                 

Definition
(GenBank) putative endoglucanase precursor
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
ksk  Kitasatospora setae
Pathway
ksk00500  Starch and sucrose metabolism
ksk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KSE_74220
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KSE_74220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2 DUF3357 TALPID3
Motif
Other DBs
NCBI-ProteinID: BAJ33177
NITE: KSE_74220
UniProt: E4NJM9
Position
8487941..8489404
Genome map
AA seq 487 aa AA seqDB search
MHPTDPQAPRRRAAAAPVRPTRRAAALALAAATAAVGLVAAAQGGADAAVQGSLPADTQF
YKDPASQAVKWTAANPGDSRARVIGKRIASQPQGIWFANYRPDTITSDVRTVASAAAQAG
QVPVLVAYMIPNRDCGGASADGAPDLASYDAWVGKFAAGLGSSRSVVVLEPDSIALTTCL
GAQQQNDRFASLARAVTTIRAAAPNAKVYLDGGHSTWNSAAEQANRLRGAGVLNADGFFT
NVSNFNPTANEAGYAHGVLNALGNPGNLHAVIDTSRNGNGPAGSTWCDPSGRKIGNYPTA
ATNDSGIDAYLWIKPPGEADGCAAAAGTFVPDIAYQLAVNAADPSTPAPTPTPTPTPTPT
PTPTPSPSQSSQPPTSQPPAGNASCSIAYRANSWAGGFTADVTLKNTGSAAISGWKLAWT
FPGDQKITSAWNATVVQSGAAVTATDLGYNGTLAAGASTNFGLQATYGSNNTAPSAFTLN
GTACTTS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccccaccgacccccaggccccccgacggcgcgccgccgccgcgcccgtccggccg
acccgtcgcgccgccgccctcgccctcgccgccgcgacggcggccgtcgggctggtggcc
gccgcccagggcggcgcggacgcggccgtgcagggcagcctccccgccgacacccagttc
tacaaggacccggcctcgcaggccgtgaagtggacggccgccaacccaggggactcccgc
gcccgggtgatcggcaagcggatcgccagccagccgcagggcatctggttcgccaactac
cgccccgacacgatcacttcggacgtccgcacggtcgcctcggccgccgcccaggccggc
caggtgccggtgctggtggcctacatgatcccgaaccgggactgcggcggcgcgtccgcc
gacggcgctcccgacctcgcctcgtacgacgcctgggtcggcaagttcgcggccgggctg
ggcagttcgcgttcggtcgtggtgctggaacccgactcgatcgcgctcaccacctgcctc
ggcgcccagcagcagaacgaccggttcgcctcgctggcccgcgccgtcaccaccatccgc
gccgccgccccgaacgccaaggtctacctcgacgggggccactccacctggaactccgcc
gccgaacaggccaaccggctgcgcggcgcgggcgtgctgaacgcggacggcttcttcacc
aacgtctccaacttcaaccccaccgccaacgaggccggctacgcccacggcgtgctcaac
gccctcggcaaccccggcaacctgcacgccgtgatcgacaccagccgcaacggcaacggc
ccggcgggcagcacctggtgcgacccgtccggccgcaagatcggcaactacccgaccgcc
gcgaccaacgacagcggcatcgacgcctacctgtggatcaaacccccgggcgaggccgac
ggctgcgccgccgcggccgggacgttcgtccccgacatcgcctaccagttggcggtgaac
gcggccgacccgagcaccccggcgcccaccccgacgccgactcccactcccacgccgacc
ccgaccccgacgccgtccccgtcgcagtccagccagccgccgacctcgcagccgccggcc
gggaacgcgtcctgctcgatcgcgtaccgggccaactcctgggcgggcggcttcaccgcc
gacgtcacgctgaagaacaccggcagcgccgcgatctccggctggaagctggcctggacg
ttccccggcgaccagaagatcaccagcgcctggaacgccaccgtcgtgcagagcggtgcc
gccgtcaccgccaccgacctcggctacaacggcaccctggcggccggcgcgtccaccaac
ttcggccttcaggccacctacgggtcgaacaacaccgccccgagcgccttcacgctgaac
ggaaccgcctgcaccacctcctga

DBGET integrated database retrieval system