KEGG   Kitasatospora setae: KSE_75810tHelp
Entry
KSE_75810t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-ProteinID: BAJ33334
NITE: KSE_75810t
UniProt: E4N413
Position
complement(8674854..8675303)
Genome map
AA seq 149 aa AA seqDB search
MPTPQIQQQLSEAAVRRLVEDWYRALDRHDPVEDVLPHLAADGLVMRFPEGTAHGHEGFR
SWYDAVTHRFFDEAHTVLTVDVEEIRAASAEVRVLVNWQTRTWKAPDATSTWLGFDAHQS
WSVVLEDGTPRIRAYTVDSLTPMPGSAGL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgccccagattcagcagcagctcagcgaggccgccgtacgccggctcgtggag
gactggtaccgcgcgctggaccggcacgaccccgtcgaggacgtcctgccccacctggcc
gccgacggcctggtcatgcgctttcccgagggcaccgcgcacgggcacgagggcttccgc
tcctggtacgacgcggtgacgcaccggttcttcgacgaggcgcacaccgtgctcaccgtg
gacgtcgaggagatccgcgccgcctccgccgaggtgcgggtcctcgtcaactggcagacc
aggacgtggaaggcgccggacgccaccagcacctggctgggcttcgacgcccaccagagc
tggagcgtcgtcctggaggacggcaccccccgcatccgcgcctacaccgtcgactccctg
actccgatgcccggctccgccgggctctga

DBGET integrated database retrieval system