KEGG   Kitasatospora setae: KSE_75990tHelp
Entry
KSE_75990t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ33351
NITE: KSE_75990t
UniProt: E4MZ34
Position
8695864..8696616
Genome map
AA seq 250 aa AA seqDB search
MPRNAETPLNFSGPRVQALLVQDVKDYHVSGPAVVVNTGTSDVHLARTPRKAIPPLSSTI
LTGVRIEEAASLLILRVKDDTDIAGIAREPGWDLLGDLLGDSTTPTEDATLPFPRDTPLW
KSPQDHAGLIELDPAHLLAERAEPRRLQPFEIRANLWFAPAGTDCFIHNQHDFIEVHTQL
HGLGRMQKFTEQDHSTLYEDLPMSPGYTTSQPFCSTGPDGTYLYPWHQYRADTDCVWLAV
EYHPMPHRHP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtaacgccgagaccccgctcaacttcagcggcccgcgcgtccaggccctcctc
gtccaggacgtgaaggactaccacgtcagcggaccggccgtcgtcgtcaacaccggcacc
agcgacgtccacctcgcccgcaccccgcgcaaggccatccccccgctctcctccaccatc
ctcaccggcgtccggatcgaggaggccgcctccctcctgatcctgcgcgtcaaggacgac
accgacatcgccggcatcgcccgcgaacccggctgggacctcctgggagacctcctcggc
gacagcaccacccccaccgaggacgccaccctgcccttcccgcgcgacaccccgctctgg
aagagcccccaggaccacgccggcctcatcgaactggaccccgcccacctgctcgccgag
cgcgccgaaccccgccgcctccagcccttcgagatcagggccaacctctggttcgccccg
gccggcaccgactgcttcatccacaaccagcacgacttcatcgaggtgcacacccagctc
cacggcctgggccggatgcagaagttcaccgagcaggaccacagcaccctctacgaggac
ctgccgatgagccctggctacaccacttcccagcccttctgctccaccggccccgacggc
acctacctctacccctggcaccagtaccgcgccgacaccgactgcgtctggctcgccgtc
gagtaccaccccatgccccaccgacacccgtag

DBGET integrated database retrieval system