KEGG   Kitasatospora setae: KSE_76020tHelp
Entry
KSE_76020t        CDS       T01648                                 

Definition
(GenBank) putative hydrolase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 FSH1 Thioesterase Abhydrolase_5 Abhydrolase_4 Ser_hydrolase LIP DUF4514 Esterase
Motif
Other DBs
NCBI-ProteinID: BAJ33354
NITE: KSE_76020t
UniProt: E4MZ31
Position
8699338..8700123
Genome map
AA seq 261 aa AA seqDB search
MPTVHAAGTDVHYRTEGTGPGLLLVHGSTADSETNFADLRPRFTARHTVITPDYAGSGLT
ALPEGPLTLDHLVAQVTAAARAAGADRSAPVDVVGLSLGAVVAAALAARHPHLVRRLVLV
GGWARNDDPRQEALLGLWRRLADLDTEAYQQFITLLAVSPAGLAGLDRAALAKAASTAVP
SEGARRQIDLDLTVDIRDLLPAIHTPTLVVGATQDQVIPVGHSRELHRAIRGSRYAEIDS
GHNIPYERPAELTALITDFLR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtccacgcagcaggaacagacgtccactaccgcaccgaaggaaccggcccc
ggcctgctcctcgtccacggctccaccgccgactccgagaccaacttcgccgacctgcgc
ccccgcttcaccgcgcggcacaccgtcatcacccccgactacgccggcagcggcctcacc
gcactgcccgagggaccactgaccctcgaccacctggtcgcccaggtcaccgccgccgcc
cgcgccgcgggagcggaccgctccgcccccgtcgacgtggtcggcctctccctcggcgcc
gtcgtcgccgcggccctggccgcccggcacccgcacctcgtgcgccgcctcgtcctggtc
ggcggctgggcccgcaacgacgacccccgccaggaagcgctcctgggcctctggcgccgc
ctcgccgacctcgacaccgaggcctaccagcagttcatcaccctgctcgccgtctccccg
gccggcctcgccggactggaccgcgccgccctcgccaaggccgcctccaccgccgtgccc
tccgagggagcccgccgccagatcgacctcgacctcaccgtcgacatccgcgacctcctg
cccgccatccacaccccgaccctggtcgtcggcgccacccaggaccaggtcatccccgtc
ggacactcccgcgaactccaccgcgcgatccgcggcagccgctacgcggagatcgacagc
ggccacaacatcccctacgagcgacccgccgaactcaccgcgctcatcaccgacttcctg
cgctga

DBGET integrated database retrieval system