KEGG   Kitasatospora setae: KSE_76030tHelp
Entry
KSE_76030t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: BAJ33355
NITE: KSE_76030t
UniProt: E4MZ30
Position
complement(8700218..8701192)
Genome map
AA seq 324 aa AA seqDB search
MSIRLSVLDQTPVGEDFSPAEALRASVDLAEAADRLGFTRYWVAEHHNSPGFAGTAPEIL
AGALLARTRHLRVGTGGVLLPRYEPLKVAEVFTVLASVYPGRVDLGIGRAGGPAHRFPQQ
LDELRRLLGMSAPGSGAEDARRAGPQMWLLGAGGSSAALAGRLGTSFAFAHFLAPAPGRA
ALEDYRREYAASGARPPAEGVLAVRVVTADTDAKAQELAQGLLLWRSRKDLGQDLPLPSP
ATARRHRWTGAEAERAAVNRRALVAGTPERVREVLTGLAAEHGVGEIVVNTLTHDPEDRL
RSLQLLAQAFGLTERGGALATAVV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcgcctgtccgtcctcgaccagaccccggtcggcgaggacttctcccccgcg
gaggcgctgcgtgcctccgtcgacctggccgaggccgccgaccgcctgggcttcacccgc
tactgggtggccgagcaccacaactcgccgggtttcgcgggcaccgcgccggagatcctg
gcgggggccctgctcgcgcgcacccgccacctgcgggtggggacgggcggggtgctgctg
ccccgctacgagccgctgaaggtggcggaggtgttcaccgtgctggcgtcggtgtatccg
ggccgggtcgatctcgggatcgggcgcgcgggtggtccggcgcaccgcttcccccagcag
ctcgacgaactgcggcggctgctggggatgtcggcgccgggttcgggcgccgaggacgcg
cggcgggccgggccgcagatgtggctgctgggggcggggggcagttcggcggcgctggcc
gggcgcctggggacgtcgttcgccttcgcgcacttcctcgctcccgctcccgggcgggcg
gcgctggaggactaccggcgggagtacgccgcctcgggggcccggccgccggccgagggg
gtgctcgccgtgcgggtggtgaccgcggacaccgacgcgaaggcgcaggagctggcgcag
gggctgctgctgtggcgcagccgtaaggacctggggcaggatctgccgttgccttcgccc
gcgacggcgcgtcgccaccggtggacgggggcggaggcggagcgggcggcggtcaaccgc
cgggccctggtggcggggacgccggagcgggtgcgtgaggtgctcaccggcctggccgcg
gagcacggggtcggggagatcgtggtgaacaccctgacgcacgatcccgaggaccggctg
cggtccctccagttgctggcgcaggccttcgggctgacggagcgcggtggcgctctcgcg
acggcggtggtgtga

DBGET integrated database retrieval system