KEGG   Kitasatospora setae: KSE_76080tHelp
Entry
KSE_76080t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: BAJ33360
NITE: KSE_76080t
UniProt: E4MZ25
Position
8705827..8706462
Genome map
AA seq 211 aa AA seqDB search
MPEHHPAFCVLLGPDYAGKSSALSLLRDTVPWRTLSVDDTHLAPEHTLLTSLRRDLVREV
AGRPGAWSPDFLATMLQTAAVHLRDRLCADPHTPAVVDSYYYKLLAKGRLAGADDHAGFA
WWRTFPQPRRVVYLDVRPATAWRRSHDGRDLNRLEYYGPQPTADGFTRYQGDLAKTMHDE
IAHLPVTVIDGHGDPAQTAQAIRKVLAHELG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacaccaccctgccttctgcgtcctcctcgggcccgactacgcgggcaagtcc
tcggcactctccctgctgcgcgacaccgtgccgtggcggaccctctccgtcgacgacacc
cacctcgcaccggagcacaccctgctcaccagcctgcgccgggacctggtccgcgaggtc
gccggacggcccggcgcgtggtcacccgacttcctcgccacgatgctgcagacggccgcc
gtacacctgcgcgaccggctctgcgccgacccgcacaccccggccgtcgtcgactcctac
tactacaagctcctcgccaagggccggctggccggcgccgacgaccacgccggcttcgcc
tggtggcgcaccttcccccagccgcgccgggtcgtctacctcgacgtgcgccccgccacc
gcctggcgccgcagccacgacggccgcgacctcaaccgcctggagtactacggcccccag
ccgaccgcggacggcttcacccgctaccagggcgatctcgcgaagacgatgcacgacgag
atcgcccacctcccggtgacggtgatcgacggacacggcgaccccgcgcagaccgcgcag
gccatacgaaaggtactcgcgcatgaactcggctga

DBGET integrated database retrieval system