KEGG   Kitasatospora setae: KSE_76100tHelp
Entry
KSE_76100t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LCM
Motif
Other DBs
NCBI-ProteinID: BAJ33362
NITE: KSE_76100t
UniProt: E4MZ23
Position
8708299..8709156
Genome map
AA seq 285 aa AA seqDB search
MTASLDAVERTALLTAALRAAETRRPDRLYEDPYADALAGDIGPELLAQVRAATFPADGE
RTLPSTPDYNAIRTRFFDDYLKEAAADPATTQIVLAPAGMDSRAYRTDWPARVRWFEVDR
PAVLAYKQQRLGAVQARTDHRKVAVDLTSPDWEQDLQNAGYDPSAPSTWLLEGLLYYIPE
ADTHRILQRVAAISAPGSRIAADIVNADALTLAHMRGLLDVFESWGCPWLFGTNEPEALF
DQYGYTTRALQPGEDGADFGRWPDPVPPRSVQGVRRVFFVHGRRR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcactcgacgccgtcgaacgcaccgccctgctcaccgcggccctgcgggcc
gccgagacccggcgccccgaccggctctacgaggacccctacgccgacgcgctggccggc
gacatcggccccgaactcctggcccaggtgcgggccgccaccttccccgccgacggcgag
cgcaccctgcccagcacccccgactacaacgcgatccgcaccaggttcttcgacgactac
ctgaaggaggcggccgccgaccccgccaccacccagatcgtgctcgcccccgccggcatg
gactcgcgcgcctaccgcaccgactggcccgcgcgcgtacggtggttcgaggtcgaccgc
cccgccgtcctcgcctacaagcagcaacgcctcggcgccgtccaggcccgcaccgaccac
cgcaaggtcgccgtcgacctgacctcacccgactgggaacaggacctccagaacgccggc
tacgacccgtcggcgccctccacctggctgctcgaagggctgctctactacatccccgag
gccgacacccaccgcatcctccagcgggtcgccgcgatctccgcccccggcagccggata
gccgccgacatcgtcaacgccgacgccctgacgctcgcgcacatgcgcggactgctggac
gtgttcgagagctggggctgcccctggctgttcggcaccaacgaaccggaagccctcttc
gaccagtacggctacaccacccgggccctgcagcccggcgaggacggagccgacttcggc
cgctggcccgaccccgtgccgccgcgctccgtccagggcgtgcgccgggtgttcttcgtc
cacggcaggcggcgctga

DBGET integrated database retrieval system