KEGG   Kitasatospora setae: KSE_76130tHelp
Entry
KSE_76130t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ33365
NITE: KSE_76130t
UniProt: E4MZ20
Position
8711769..8712557
Genome map
AA seq 262 aa AA seqDB search
MSPSPSPVLDPAQDRLRHAAAGRVRRARPDLAARYDLDTTEGLLEAQQAVATRAGDGAGE
EGTLAAVVVRHVDLAAWVRSTCEFALALDPALARPWRRSFTRTVFLAGNPDNLRERFPFA
HTGAGAAWTPPGPDKDTAALRRLLKTFDGPAGPPARPATDILIPAGPGPHGPGGRAARHR
DLYLATAGCTLSEALVHLNHILVEAVLDGLIAPGERLTLRQIPRLTGIEAPFAALRVVAE
PHRRGRLKAAAALTEEIPPCPQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgagcccgagcccggtcctggaccccgcccaggaccggctgcgccacgccgcg
gcgggccgggtccgccgcgcccgaccggacctcgccgcccgctacgacctggacaccacc
gagggcctgctcgaagcccagcaggccgtcgccaccagggcgggggacggggcgggggag
gagggcaccctggccgccgtcgtggtgcgccacgtcgacctcgccgcctgggtacgctcc
acctgcgagttcgccctcgccctggacccggccctggcacggccctggcgccgctccttc
acccgcacggtcttcctcgcgggcaacccggacaacctgcgcgagcgcttcccgttcgcc
cacaccggcgccggcgccgcctggacaccgccgggaccggacaaggacaccgccgccctg
cgcaggctcctgaagaccttcgacgggccggccgggccgcccgcccggcccgccaccgac
atcctcatccccgccggccccggcccccacggccccggcggccgggccgcccgccaccgc
gacctctacctcgccaccgcggggtgcaccctctccgaagccctggtgcacctcaaccac
atcctggtcgaggcggtcctggacgggctgatcgccccgggggagcggctgaccctgcgc
cagatcccccggctcaccggcatcgaagcgccgttcgccgccctgcgcgtcgtcgcggaa
ccccaccgccgcggccggctcaaggccgccgccgccctcaccgaggagatccccccgtgc
ccgcaatga

DBGET integrated database retrieval system