KEGG   Kitasatospora setae: KSE_76140tHelp
Entry
KSE_76140t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate
Motif
Other DBs
NCBI-ProteinID: BAJ33366
NITE: KSE_76140t
UniProt: E4MZ19
Position
8712545..8713234
Genome map
AA seq 229 aa AA seqDB search
MPAMSAPATAATAALPEPAAATAAEPAAGTIRLGYHGSPEVAHRVTALAGLPEATVTLHP
YDITDPFRGLREGDLDLIIVKFSLREPDLAVSRVLTHDARAVVVGARHPLAARTSVSVEE
LADHDAFHRPGDLPAYVWDEVVPPRTPAGRPIRRRHRVTDIPRMMALVAEGAAVHLSLIS
LADVAPPTVRIVPVHDLPPAPVALAWHRATGLPPHAARYVTAAEQAASR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcaatgagcgcaccggccaccgccgcgaccgccgccctcccggaacccgccgcc
gcgaccgccgccgagcccgccgccgggaccatccggctcggctaccacggctcacccgag
gtcgcccaccgcgtcaccgccctcgccggcctccccgaggccaccgtcacgctccacccg
tacgacatcaccgaccccttccgcggcctgcgcgagggcgacctcgacctcatcatcgtc
aagttctccctccgcgaacccgacctcgccgtcagccgggtcctcacccacgacgcccgc
gccgtcgtcgtcggcgcccgccacccactggccgcccgcacctccgtctccgtcgaggaa
ctcgccgaccacgacgccttccaccgccccggcgacctccccgcctacgtctgggacgaa
gtcgtcccgccccgcacccccgccggccgcccgatccggcgccgccaccgcgtcaccgac
atcccccgcatgatggccctggtcgccgagggcgccgccgtgcacctctccctgatctcc
ctcgccgacgtcgcaccgcccaccgtgcggatcgtccccgtccacgacctgccgcccgcc
cccgtcgccctcgcctggcaccgcgccaccggactcccgccccacgccgcccgctacgtc
accgcggccgaacaggcggcctcccggtga

DBGET integrated database retrieval system