KEGG   Kitasatospora setae: KSE_76170tHelp
Entry
KSE_76170t        CDS       T01648                                 

Definition
(GenBank) putative cytochrome P450
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: BAJ33369
NITE: KSE_76170t
UniProt: E4MZ16
Position
8714945..8716276
Genome map
AA seq 443 aa AA seqDB search
MPAPAPCPPAPGQVPLLGHAPALLRRPLSFFEATRTAEPLVRVGFGPIRLYLANDPALVH
RIQVDTDSFERGRFFERLASNFGNPLIASDGAEHQHQRRALKPAFSRRSVRDHTSAITEE
TERRIGAWRPGTVVAADEEMSDLVAAVVLRSLFSTRLSPTTVRDIRETLFLIARRLLVRT
VFPDIVSSLPTPGNRRFAASVGRFHTTVDELIRERRANPRPHHDILQTLLTTRHPATGAP
LSDTEIRSEFLMLLFAALETTSTSLSWAVFEVARRPDVQHRLQNEADTVTAGGPLGYDRL
KNLTYTRQVIDETLRLHAPMLFTRRARHDVTLAGITVPAGSEVGYSPRAVHRDPGLYPHP
AAFDPDRTAPDSATDRPQGAYFPFGTGPHRCIGEHLALTTMTTALATLATKWNLRIAPGT
RIRETNSSLPHLSSLPLLPTPRG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcccccgccccgtgcccgcccgcgcccggccaggtgcccctgctcggccacgcc
ccggccctgctgcgccgcccgctgtccttcttcgaggccacccggaccgccgaaccgctc
gtccgggtgggcttcggaccgatccgcctctacctggccaacgaccccgccctggtacac
cggatccaggtcgacaccgactccttcgaacgcggccgcttcttcgaacggctcgccagc
aacttcggcaacccgctcatcgcctccgacggcgccgagcaccagcaccagcgacgcgcc
ctcaaacccgcgttcagccgccgaagcgtccgcgaccacacctccgccatcaccgaggag
accgaacggcgcatcggcgcctggcgcccgggcacggtcgtcgccgccgacgaggagatg
tcggacctggtcgccgccgtcgtcctgcgcagcctcttcagcacgcgcctgagccccacc
accgtccgcgacatccgcgagacgctgttcctgatcgcccgccgactcctcgtacgcacc
gtcttccccgacatcgtcagctccctgcccacccccggcaaccgccgcttcgccgcctcc
gtcggccgcttccacaccaccgtcgacgaactgatccgcgagcgccgcgccaacccccgg
ccgcaccacgacatcctgcagaccctgctcaccacccgccaccccgccaccggcgccccg
ctcagcgacaccgagatccgcagcgagttcctgatgctgctgttcgccgccctcgaaacc
accagcacctccctcagctgggcggtgttcgaggtcgcccgacgccccgacgtgcagcac
cgcctgcagaacgaagccgacaccgtgacggccggcggccccctcggctacgaccgcctc
aagaacctcacctacacccgccaggtcatcgacgagaccctgcgcctgcacgcccccatg
ctcttcacccgccgcgcccgccacgacgtcaccctcgccgggatcaccgtccccgccggc
tccgaggtcggctacagcccgcgagccgtgcaccgcgaccccggcctctacccccaccca
gccgccttcgaccccgaccgcaccgcccccgacagcgcaaccgaccgcccccagggcgcc
tacttccccttcggcaccggcccgcaccgctgcatcggcgaacacctcgccctcaccacc
atgaccacggccctggccaccctcgccaccaagtggaacctgcggatcgcccccggcacc
cgcatccgcgagaccaacagctcactcccgcacctcagcagcctcccactgctccccacc
ccccgcggatga

DBGET integrated database retrieval system