KEGG   Kitasatospora setae: KSE_76180tHelp
Entry
KSE_76180t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ33370
NITE: KSE_76180t
UniProt: E4MZ15
Position
8716273..8717238
Genome map
AA seq 321 aa AA seqDB search
MTAPAGPGRAGALRCRAHAAPTREETATPSRPPPRTPPRTSRPRTRPPKPPRASSSRPRP
SRRSSRCGSTPAPGPDRRGPKGGRPRRHGGVLTFARPDTWHTPDTATATDTARYGTAQAT
AWDRTHPRLTHRGPWLDHAEEEPPIPHGTLIRLEVECLPGDRDLKPVRLWCSATTATGTD
VDLWWQSFLRRFDLEHTFRLMKQTLGWTAPKIRHADTADLWTWLIIAAHTQIRLARPLAE
DVRRPWERPATEPRRLTPARVRRGFRNIRATAARPAAAPKPSRPGPGRPPGSKNKQRAPR
HNVGKTAKRADSIKEHQSRRG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccgccggccccggcagggccggggccctccggtgccgcgcccacgcggca
cccacccgcgaggagaccgccacgccgtcccgccccccgccgcgcacaccaccgcggaca
agccggccgaggaccaggccgccgaagccgccgagggcgagcagcagccggccccgcccg
agtcgccgatcgagtcgctgcggatcaacgcccgcccccggccccgaccgccgcgggccg
aagggcgggcgaccccgtcgacacggcggagtcctcaccttcgccagacccgacacctgg
cacacccccgacaccgccacggccaccgacaccgcccgctacggcaccgcccaggcgacg
gcctgggaccggacgcacccccggctcacccaccgcggcccctggctggaccacgccgag
gaggaaccacccatcccgcacggcacgttgatccggctcgaggtcgagtgtctgccgggc
gaccgggacttgaaaccggtccggctgtggtgctcggccaccacggccaccggcacggac
gtggacctgtggtggcagtccttcctccgccgtttcgacctggagcacaccttccggctg
atgaagcagaccctcggctggaccgccccgaagatccgccacgccgacaccgccgatctg
tggacctggctgatcatcgccgcccacacccagatccgcctcgcccggcccctggccgaa
gacgtacgccggccctgggagcgaccggcgaccgaaccccgccgtctcacccccgcccgc
gtccgccgggggtttcgcaacatccgcgcgacagcggcccgtccggcagccgcaccgaaa
ccgtcccggccaggcccgggacggccacccggctcgaagaacaaacaacgggccccacgc
cacaacgtcggcaagacggccaaacgagccgactcgatcaaggaacatcaaagccgacga
ggataa

DBGET integrated database retrieval system