KEGG   Kitasatospora setae: KSE_76250tHelp
Entry
KSE_76250t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
  KO
K03527  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase [EC:1.17.7.4]
Organism
ksk  Kitasatospora setae
Pathway
ksk00900  Terpenoid backbone biosynthesis
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
ksk01130  Biosynthesis of antibiotics
Module
ksk_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KSE_76250t
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.4  4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase
     KSE_76250t
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_C
Motif
Other DBs
NCBI-ProteinID: BAJ33378
NITE: KSE_76250t
UniProt: E4MZ07
Position
8722968..8724014
Genome map
AA seq 348 aa AA seqDB search
MHRTRLTEFFPLHHQVGPEPTVPRGFVHPERGRVACPAAPLVEAHLRAEGLLTGAGGPAP
ELLPVPAQRVRDGGVLACTTYIDLDGSVTGIAVTAPRALETAARDAVQRWAAVLRTRRIV
IALGEPCRQAARSAPGHAGCPKAAATRELVRQYRERGDTVLVLGAAGECDSASAHALPDV
AAALRFEPDDDTRLSFVLAPCSPVEAAMPVLRVLRARFPALRGQHPDQWCYAASDARLGA
RMVTETSDLVLDLGASAAPTDGADAPSRRTVRRVRTLADLRPEELAAAATVGVLPQLSGR
ERPDDSPTVTDVIEVLSGLGPLSVVHHRASTDVSTNVYERSALAHSAR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggacacggctgacggagttcttcccgctgcaccaccaggtcggcccggagccg
acggtgccgcgcggattcgtccacccggagcgcggccgcgtcgcgtgtccggccgccccg
ctcgtcgaggcgcacctgcgcgcggagggactcctgaccggagcgggcggccccgcgccg
gagctcctgcccgttcccgcccaacgggtccgcgacggcggcgtcctggcgtgcaccacc
tacatcgacctcgacggctcggtgaccgggatcgcggtcaccgccccgcgggcgctggag
accgccgcccgcgacgccgtccagcgctgggccgccgtgctgcggacccggcgcatcgtc
atcgccctcggcgagccctgccggcaggcggcgcggtccgctcccgggcacgccggctgc
ccgaaggcggccgcgacccgggagctggtgcggcagtaccgggagcggggcgacacggtc
ctcgtgctgggagcggcgggcgagtgcgacagcgcctccgcgcacgcgctccccgacgtc
gcggccgccctccgcttcgagcccgacgacgacacgaggctctccttcgtcctcgccccc
tgctcgccggtcgaggccgcgatgcccgtgctgcgggtcctgcgcgcccggttccccgcg
ctgcgcggccagcaccccgaccagtggtgctacgcggcctcggacgcccgcctcggcgcc
cggatggtgacggagaccagcgacctggtgctcgacctcggagcctccgccgccccgacc
gacggtgcggacgcgcccagccgccgtacggtccggcgcgtccgcaccctcgccgacctc
cgccccgaggaactcgccgccgccgccacggtcggcgtcctgccgcagctgtcgggacgg
gagcggcccgacgactcgcccaccgtcaccgacgtgatcgaggtcctgtcgggcctcggc
ccgctcagcgtcgtccaccaccgcgccagcaccgacgtcagcaccaacgtctacgaacgc
tcggcactcgcgcactcggcccggtag

DBGET integrated database retrieval system