KEGG   Kitasatospora setae: KSE_76310tHelp
Entry
KSE_76310t        CDS       T01648                                 

Gene name
groS4
Definition
(GenBank) putative 10 kDa chaperonin
  KO
K04078  chaperonin GroES
Organism
ksk  Kitasatospora setae
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ksk03110]
    KSE_76310t (groS4)
   03029 Mitochondrial biogenesis [BR:ksk03029]
    KSE_76310t (groS4)
Chaperones and folding catalysts [BR:ksk03110]
 Heat shock proteins
  HSP10
   KSE_76310t (groS4)
Mitochondrial biogenesis [BR:ksk03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    KSE_76310t (groS4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-ProteinID: BAJ33383
NITE: KSE_76310t
UniProt: E4MZ02
Position
complement(8729591..8729944)
Genome map
AA seq 117 aa AA seqDB search
MTPRSLARLCLTALLVGGLTWTAGPAASAAPAAVLRPVAPAAVAAPAGYVMVSTHEIAAT
EVLGVDLLAGRVSAVGIGLDIAPGETVIFAKYSGTEIRLDGEDYLQLSGNEILAVVG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgcgttccctcgcacgcctctgcctgaccgccctcctggtgggcggcctcacc
tggaccgccggcccggcggcctcggccgccccggccgccgtcctccgcccggtcgccccg
gcggcggtcgcggcgcccgccggctacgtgatggtgtcgacccacgagatcgccgccacc
gaggtcctcggggtggacctcctcgcgggccgcgtctccgcggtcggcatcggcctggac
atcgcaccgggcgaaacggtgatcttcgcgaagtacagcggtaccgagatccggctcgac
ggcgaggactacctgcagctgagcgggaacgagatcctcgccgtcgtcggctga

DBGET integrated database retrieval system