KEGG   Kitasatospora setae: KSE_76360tHelp
Entry
KSE_76360t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ33388
NITE: KSE_76360t
UniProt: E4MYZ7
Position
8733601..8734182
Genome map
AA seq 193 aa AA seqDB search
MDPRSPVPPRLRGRRPRRPPNALPLLLALLLAAAALVLPAPPARAAGSLLDCPGTATSTY
APPLTAAGAPTTITLSEVLTPCAAPGTAVTSGTASLVVPVPTPYPCGQLAGSGTLTRTIT
WNTGQTSTLTGTYTATFVGATIVGNGSGTVVSGLFAGQPFTDVRVTPSEQVLRCEAALAT
VSGTVAVTDLLIG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggatccccgctcgcccgtaccgccgaggctccggggccgacggccccgccgcccgccg
aacgcgctcccgctgctgctcgccctgctgctcgcggcggcggcgctggtcctgcccgcc
ccgccggcccgcgccgccgggtccctgctcgactgcccgggcaccgcgacgagcacctac
gccccgccgctcaccgcggcgggcgccccgaccacgatcacgctctccgaggtgctgacg
ccctgcgcggcgcccggcaccgccgtcacctccgggacggcgtccctcgtggtgccggtg
ccgacgccctacccctgcggccagctggcgggcagcggcacgctcacccggaccatcacc
tggaacaccggccagacctccaccctgaccggcacgtacacggccaccttcgtcggcgcc
accatcgtgggcaacggcagcgggaccgtcgtctcgggcctgttcgccggacagcccttc
accgacgtacgcgtcaccccgtccgaacaggtcctgcgctgcgaggccgcactcgccacg
gtctccggcaccgtcgccgtgaccgacctcctgatcggctga

DBGET integrated database retrieval system