KEGG   Kitasatospora setae: KSE_76370tHelp
Entry
KSE_76370t        CDS       T01648                                 

Definition
(GenBank) putative oxidoreductase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox FAD_binding_2 FAD_binding_3 3HCDH_N HI0933_like NAD_binding_9 GIDA
Motif
Other DBs
NCBI-ProteinID: BAJ33389
NITE: KSE_76370t
UniProt: E4MYZ6
Position
8734265..8735779
Genome map
AA seq 504 aa AA seqDB search
MGSREPDTTETPGAGGRGGQAFDVVVVGNGVLGMSLAVVLLRRGARVAVVGDGNRPLAAS
TASGAMNGCFGEVTATTTATAHGRARLEMDVLAARLWDDWLAGLEEDGGATVRCARGTLV
IHNTIGMAEIDDTAMTAIRAALELHGEPFESVDPTEAVPWLDPQPTARPLAGLFLPREHG
VDSGALLKVLHRAVVRLGGVLVPEHAVRVVHGAGRAGGIALADGTVLAGDRVVLAAGVGT
QALMDSLPPEVSAPVPRLISGFGVSVVLSNGPAAAPPDCVVRTPNRSFGCGLHTVPRGPD
RVYVGATNTTRPRPGSDPSVRDLAFLLDCAARQLRRDLWFSDITATRVGNRPMTLDGHPL
LGETLLPGLWLMTGTFRDGLHTSPLLASRLADRILDGTPPTPEMDLFRPTRPPIQTMDRR
DTVRHATVHRLAVGHEWNWSLPVEWPVHLEEMYEAKYRAVAERTHDTITPPPEVLAYIPA
FPELADMLDAYYTASRPRLGASGD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgggaagtcgggaaccggacacgacggagacccccggggcgggcggccggggcgggcag
gcgttcgacgtggtggtggtcggcaacggggtgctggggatgtccctggcggtggtgctg
ctgcggcggggcgcgcgggtggcggtggtcggcgacgggaaccggccgctggccgcgtcg
acggcgtccggggcgatgaacgggtgcttcggcgaggtgaccgcgaccacgacggccacc
gcgcacgggcgggcccggctggagatggacgtgctcgcggcccgcctgtgggacgactgg
ctcgccggactggaggaggacggcggcgcaacggtccggtgcgcgcggggaacgctcgtc
atccacaacacgatcggcatggcggagatcgacgacaccgcgatgacggcgatccgcgcc
gcgctggagctccacggggagcccttcgagagcgtcgatcccaccgaggccgtcccctgg
ctcgatccgcagccgaccgcccggccgctggccggcctcttcctcccccgcgagcacgga
gtcgactccggcgcgctgctcaaggtcctgcaccgcgccgtcgtccggctgggaggcgtc
ctggtccccgagcacgccgtccgcgtcgtccacggcgcgggccgggccggcgggatcgcc
ctggccgacgggacggtgctggccggtgaccgggtggtgctggccgccggcgtcggcacc
caggcgctgatggactcgctgccccccgaggtcagcgcccccgtaccccggctgatcagc
gggttcggcgtgtcggtggtcctgtcgaacggcccggccgccgccccgccggactgcgtc
gtgcgcacccccaaccgctccttcggctgcgggctgcacaccgtgccgcgcggtcccgac
cgggtctacgtgggcgccaccaacaccacccggccccgcccgggcagcgaccccagcgtc
cgcgacctggcgttcctgctggactgcgccgcccggcaactgcgcagggacctgtggttc
agcgacatcaccgccaccagggtcgggaaccggccgatgaccctggacggccaccccctc
ctcggagagaccctcctgccggggctgtggctgatgaccggcacctttcgcgacggcctg
cacacctccccgctcctggcctcccggctggccgaccggatcctcgacggaacgccgccc
acaccggagatggacctcttccggccgacccggccaccgatccagaccatggaccgccgg
gacaccgtccgccacgccaccgtgcaccgcctggccgtcggccacgagtggaactggtcg
ctgcccgtcgaatggcccgtccacctcgaagagatgtacgaggccaagtaccgggccgtc
gccgagcggacccacgacaccatcaccccgccgccggaagtcctcgcctacatccccgcc
ttccccgagctcgccgacatgctcgacgcctactacaccgccagccggccccgcctgggc
gcctccggcgattga

DBGET integrated database retrieval system