KEGG   Kitasatospora setae: KSE_76430tHelp
Entry
KSE_76430t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ33394
NITE: KSE_76430t
UniProt: E4MYZ1
Position
complement(8741123..8741581)
Genome map
AA seq 152 aa AA seqDB search
MMLTARQRGERSGREKCTSMELISGAGLHSRPWPELMPDGRPALILPAAPDRPVIAQDGW
ADRTTAFDPAAGPQPGWSAVLDDYRLTLHRPGGTAWFDGEIGADRHWRRRLRDHRTLLLI
TGPFTGVFDFRPAAEAGRLSLLTTPARLASDL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgaccgccaggcagcgaggtgagcgatccggacgggagaagtgcaccagcatg
gagctgatcagcggcgccggcctgcactccaggccctggccggagctgatgcccgacggg
cgcccggcgctgatcctccccgccgcccccgaccgcccggtgatcgcccaggacggctgg
gccgaccgcaccaccgccttcgacccggccgccgggccacaaccgggctggtcagcggtc
ctggacgactaccggctgaccctccaccgccccggcgggacggcctggttcgacggcgag
atcggcgcggaccggcactggcgccgccgcctgcgtgaccaccgcaccctgctgctgatc
accggcccgttcaccggcgtcttcgacttccggcccgcggccgaggccggacggctgtcc
ctcctcaccaccccggcccggctcgccagcgacctctga

DBGET integrated database retrieval system