KEGG   Kitasatospora setae: KSE_76440tHelp
Entry
KSE_76440t        CDS       T01648                                 

Definition
(GenBank) putative transposase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4096 DDE_Tnp_1 DDE_Tnp_1_2 DDE_Tnp_1_3 DDE_Tnp_4
Motif
Other DBs
NCBI-ProteinID: BAJ33395
NITE: KSE_76440t
UniProt: E4MYZ0
Position
complement(8741706..8742560)
Genome map
AA seq 284 aa AA seqDB search
MARRRCYPSDTWDEEWKLLEPLLPVPACETKAGGRPEKHPRREIVDAIRYVVDTGCKWRA
LPKDFPPWRTAYGFMARWAAAGVVGRIRDQLRRRIRRDMGRGPEAVATIIDSQSVKAAET
VGKDSRGYDAAKKINGRKRHLVVDTKGLPLFVMVTPADVTDRDAAKEVLFRLRLMHPEIT
IVWADSAYAGQLVSWAKKYLNLTVKTVNRPKEAKGFVVLPRRWVVERTHAWVMHARRHAR
DYERLVQHSESLITWATITVMTRRITRRNSTRTGQTASRETQRD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccgccgctgctacccctcggacacctgggacgaggagtggaagctgctggag
ccgctgctgcccgtcccggcctgtgagacgaaggccggcgggcgcccggagaagcacccg
cgccgcgagatcgtggacgcgatccgctacgtcgtggacaccggctgcaagtggcgggcc
ctgccgaaggacttcccgccctggcggacggcttacgggttcatggcccgctgggcggcg
gccggggtggtcggccgcatccgcgaccagctccgccgacgcatccgccgggacatgggc
cgcggcccggaggcggtcgccacgatcatcgactcgcagtcggtgaaggccgccgagacc
gtcgggaaggactcgcgcggctacgatgccgcgaagaagatcaacggcaggaagaggcac
ctggtcgtggacaccaagggcctgccgctgttcgtgatggtcacccctgccgacgtcacc
gaccgcgacgcggcgaaggaggtgctgttccggctcaggttgatgcacccggagatcacg
atcgtctgggccgactccgcctacgcgggccagctggtgagctgggcgaagaagtacctg
aacctcacggtcaagaccgtcaaccggcccaaggaggccaaggggttcgtggtcctgccc
cggcgctgggtggtcgagcgcacccacgcctgggtgatgcacgcccgccggcacgcgcgc
gactacgaacggctcgtccagcactccgaatcgctgatcacctgggccacgatcaccgtg
atgaccaggagaatcacccggcgcaactccacccggaccggacagacggcctcccgcgaa
acccagcgggactga

DBGET integrated database retrieval system