KEGG   Kitasatospora setae: KSE_76460tHelp
Entry
KSE_76460t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtE_N
Motif
Other DBs
NCBI-ProteinID: BAJ33397
NITE: KSE_76460t
UniProt: E4MYY8
Position
complement(8743067..8744188)
Genome map
AA seq 373 aa AA seqDB search
MAQEIETTADKVGSVSASRYEEIVALLREVVENQTRGQFTIGDAALEIEPMREPGGSAPA
DEMFSVKQSLARLAEDIGLTFSSVSGTRWVASRWPKERRQPKVSYTVHRTLAGIADEGER
FAAILTPPGKKGRWTADEANRRVGRQVEIPVTPQEKVSAIHALAKDEEVAATVTGDFLRR
PEVVAQVQPQDRVRVVEELTRDDQVAAAVAPSFLRRPEVVARVAPAEKVRVVQELTRDET
VAAEVTTGLLRRPDVAARAMADDTARHQVNHAQVERGRQAREHFEQTNPVAPAVKNIDRT
VEFLDLVTACHAFVAAAGRVVPGLRDRQLSEDEQAVIRENCARVRATLDWVETAVDTGKV
DMDGELARLLQGE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggagatcgagacgacggccgacaaggtcggcagcgtcagcgccagccgctac
gaggagatcgtggccctgctgcgcgaggtggtggagaaccagacccgcggccagttcacg
atcggggacgcggcgctggagatcgagccgatgcgcgagccgggaggctcggcgccggcg
gacgagatgttcagcgtcaagcagtcgctggcccggctggcggaggacatcggcctgacc
ttctcgtcggtcagcggcacgcgctgggtggcgtcgcggtggccgaaggagcgtcggcag
ccgaaggtgtcctacaccgtccaccggaccctggcgggcatagccgacgaaggcgagcgg
ttcgcggcgatcctcaccccaccggggaagaagggccggtggacggcggacgaggcgaac
cggcgggtcgggcggcaggtcgagatcccggtgacgccgcaggagaaggtcagcgcgatc
cacgccctggccaaggacgaggaggtcgccgcgacggtgaccggcgacttcctgcgccgg
cccgaggtggtcgcgcaggtccagccgcaggaccgcgtccgggtggtggaggagctgacc
cgcgacgaccaggtcgccgcggcggtcgcgccctcgttcctgcgccggcccgaggtggtg
gcccgggtcgccccggccgagaaggtccgggtcgtccaggagctgacccgcgacgagacg
gtcgccgcggaggtgaccaccggcctgctgcggcgcccggacgtcgcggcccgcgcgatg
gccgacgacaccgcccgccaccaggtcaaccacgcccaggtcgagcggggccgccaggcc
cgcgagcacttcgagcagaccaaccccgtcgcgccggcggtgaagaacatcgaccggacg
gtggagttcctcgacctggtcaccgcctgccacgcgttcgtcgccgctgccggccgggtg
gtcccgggccttcgcgaccggcagctgagcgaggacgagcaggccgtgatccgggagaac
tgcgcgcgggtccgcgccaccttggactgggtggagaccgcggtggacaccgggaaggtg
gacatggacggcgagctggcccgcctgctccagggcgagtag

DBGET integrated database retrieval system