KEGG   Kitasatospora setae: KSE_76540tHelp
Entry
KSE_76540t        CDS       T01648                                 

Definition
(GenBank) putative sesquiterpene cyclase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: BAJ33405
NITE: KSE_76540t
UniProt: E4MYY0
Structure
PDB: 

Position
8750526..8751542
Genome map
AA seq 338 aa AA seqDB search
MAEFEIPDFYVPFPLECNPHLEEASRAMWEWIDANGLAPTERARDRMRRTGADLSGAYVW
PRADLDTLTIGLKWIALTFRIDDQIDEDDTAERLPARMTAIDELRGTLHGLPVSGRSPTA
RALGALWQETALGRPATWCDAFIGHFEAFLQTYTTEAGLNAHGAGLRLDDYLDRRMYSVG
MPWLWDLDELRLPIFLPGSVRTCGPMNKLRRAGALHIALVNDVFSVERETLVGYQHNAVT
IIREAQGCSLQEAVDQVAVLVEAQLHTVLQARQELLEELDRQALPSRAREAAVDYAANVA
ANLSGQLVWHSSVERYAVDDLQSAADPRATPTTSSLGI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcgagataccggacttctacgtccccttccccctggagtgcaatccgcac
ctggaggaggcgtcccgggcgatgtgggagtggatcgacgcaaacggcctcgcgcccaca
gaacgggcacgcgacaggatgcggcgcacgggagccgacctctcgggggcgtatgtgtgg
ccccgcgccgacctcgacacactgacgatcggtctgaaatggatcgcgctgaccttccgg
atcgacgaccagatcgacgaggacgacaccgcggagcggctgccggcccggatgacagcc
atcgacgagctgcgcggcaccctgcacggactcccggtctccgggcggtcaccgaccgcc
cgggccctgggcgccctgtggcaggagaccgccctcggacggcccgctacctggtgcgat
gccttcattgggcacttcgaggcgttcctccagacctacacaaccgaggccggcctcaac
gcccacggcgccggactccgcctcgacgactacctcgaccgcaggatgtactcggtcggc
atgccctggctttgggacctcgacgaactgcgccttccgatcttcctgcccggctccgta
cgaacctgcggcccgatgaacaaactgcgccgggccggcgcgctgcacatcgcgttggtg
aacgacgtcttctccgtcgaacgggagaccctcgtcgggtaccagcacaacgcggtcacc
atcatccgagaagcacagggctgctcgctgcaggaagcggtggaccaagtggcggtcctc
gtcgaagcccagctccacacggtgctgcaagcccggcaggaactcctcgaagaactcgac
aggcaagccctgccgtcacgggctcgcgaggccgcagtcgactacgcggccaacgtcgcc
gccaacctgagcgggcagctcgtttggcactcctcggtcgaacggtatgccgtcgacgac
ctccagtccgcggccgatccacgggctaccccgacgacctcctctctgggaatatag

DBGET integrated database retrieval system