KEGG   Kitasatospora setae: KSE_76600tHelp
Entry
KSE_76600t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII DEAD Helicase_C
Motif
Other DBs
NCBI-ProteinID: BAJ33411
NITE: KSE_76600t
UniProt: E4MYX4
Position
complement(8757126..8760308)
Genome map
AA seq 1060 aa AA seqDB search
MYTSTEVWADPAKYEKNHVRQLLVPASELDVTESGGAKRVHSVFGSWPAVDAAHDVPQEA
EALTAVLPAGASSGVVGWRGSLARTGPDSVRRSLRGSIGYRPHDEPGSLRRPQLGALHAV
MAHWVSGLPDPGVVVMPTGTGKTETMLAVLVAGRVERLLVLVPSAALRDQLAGKFETLGV
LQRERIVSAGALRPCVGRLEHSFKDPDEAARFAQACNVVVATPQVLNACSPAVRAKLLGA
FSHLIVDEAHHAPAATWARVIDTFADRPVLLFTATPFREDGRRLPGRVIFRFPLREAQRD
GIFGRINYRAVLGLRDTDRELAEAAVERLRSDLDAGFDHLMMVRAESIPKAEEIVEIYRE
LAPGFAPTVVHQNVGARRRTAAVRALRDRSCRIIVCVDMLGEGFDEPALKIAAMHAARRS
LSPMLQFIGRFARARKDLGEATVFVAQEPGAGVSPLRQLLREDADWNLLLDRLTDGAASS
AEETSAFDATFADAPDDVAVSVLEPKMSAVAYRAASGQWNPEAALGLFRKNARVLDETVA
TGGQDNPVAWFVVEHRTAVRWGAPQALEQVVYELYILYFDVARRLLYIHGSEKSGAYKEL
AEAVLGPDCELINGARTYRVLAGVDRLIPSNVGLKDARNHFTRFSLHVGSDVSQGFDTSQ
EHKSQTHIAASGFENGEGVSISAAYAGRFWTPTTAPDLKAWTDWCDHQGSKLLDDSINVE
RVFDGFIIPEDIDERPEYVLLAVQWPWQIHTDAGRRLTVHHDGRSCSMTDIDFEVDDHSP
TGPFRFSLVSTAWRIPYQADYENRRLVYRPLGSDAKVRSSTRGTQALPLQAWLNIHRPEL
FLEGDRLIDDEGRLLNPRYARLPFDTSGFVPLAWQGVDLTKESQGPERRPDSIQFHMSAH
LRASSAFDVLIDDDGPGEAADLVGLRVVDNKYLDITLVHCKYTKAAAGRRVKDLYEVCGQ
AVRSAKWRRGRTLSLLDHLRDRAQKYTARTGISPYEIGGPRELLAIHDIARTLIPRFHTV
VVQPGLQAEHATHDQLLLLAGAEQYVRHATAGDFAVYCSP
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgagcaccgaggtgtgggccgatcccgcgaagtacgagaagaaccatgtccgc
caactcctcgtccctgcgagcgagttggatgtcactgagagcggcggggcgaaacgggtg
cacagcgtcttcggaagctggccggccgtcgacgcggcgcacgacgtaccgcaggaggcc
gaggcgctgacggcggtgctccccgccggcgcgtcctcgggcgtggtgggctggcggggc
agcctggcccgcaccggtcccgacagcgtcaggcggtcgctgcgcggctccatcggctac
cgcccccacgacgagccgggcagcctgcgccgcccccaactcggcgcgctgcacgccgtc
atggctcactgggtctccggactgcccgatccgggtgtggtggtgatgccgaccggcacg
ggcaagacggagaccatgctcgccgtgctggtggccggccgggtggaacggctcctggtc
ctggttcccagtgctgcgctgcgcgaccagctcgccgggaagttcgagacgctgggcgtc
ctgcagcgcgagcgcatcgtgtcggccggcgcgctgcgcccgtgtgtgggccggctggag
cactccttcaaggacccggacgaggctgcccggttcgcgcaggcctgcaatgtggtcgtg
gccacccctcaggtgctcaacgcctgctcgccggccgtccgggcgaaactgctgggcgct
ttctcccacctgatcgtcgacgaggcccaccacgcccccgccgccacctgggcacgcgtg
atcgacacgttcgccgaccggcctgtcctgctgttcaccgcgaccccgttccgggaagac
ggccggcgcctgccggggcgcgtcatcttccgcttcccgctccgggaggcgcagcgcgac
gggatcttcgggcggatcaactaccgtgccgtcctggggctgcgggacaccgaccgggaa
ctcgcggaggccgcggtggagcggctgcgcagcgatctggacgccgggttcgaccacctg
atgatggtgagggcggagagcatcccgaaggcggaggaaatcgtcgagatctaccgggag
ctggctcccgggttcgcgccgacggtggtccatcagaacgtgggcgcccgccgccgcacc
gccgccgtgcgggcgctgcgggaccgcagctgccgcatcatcgtctgtgtcgacatgctc
ggggagggcttcgacgagccggcgctgaagatcgccgccatgcacgcggcgcgcaggagc
ctgagtccgatgctgcagttcatcggccgcttcgcccgggcccgcaaggacctgggcgag
gcaaccgtcttcgtcgcccaggaacccggcgccggcgtgtcgccgctgcgccagctgctg
cgggaggacgccgactggaacctgctgctggaccgtctgaccgacggcgccgcgtcgagc
gccgaggagaccagcgccttcgacgccacgttcgccgatgccccggacgatgtcgcggtc
agcgtcctggagccgaagatgagcgccgtcgcctatcgcgcggcgagcgggcagtggaat
ccggaggccgcgctcggcctgttccgcaaaaacgcccgggtcctcgacgagaccgtcgcc
accggcggccaggacaacccggtcgcgtggttcgtcgtcgagcaccgcaccgccgtccgc
tggggcgcgccacaggcacttgaacaagtcgtctacgagctctacatcctgtacttcgac
gtcgcccggcggctgctgtacattcacggctcggagaagtccggggcctacaaggaactc
gccgaggcagtgctggggccggactgcgaactgatcaacggggcgcgcacctaccgggtg
ctggccggggtggaccggctcatccccagcaacgtggggctcaaggacgcccgcaaccac
ttcaccaggttctccctgcacgtcggcagcgacgtctcccagggcttcgacacctcccag
gagcacaagagccagacccacatcgccgcgtccgggttcgagaacggcgagggcgtctcc
atcagcgccgcctacgccgggcggttctggaccccgaccaccgcccccgacctcaaggcc
tggaccgactggtgcgaccaccagggcagcaagctcctggacgacagcatcaacgtcgaa
cgggtcttcgacggattcatcatccccgaggacatcgacgaacgacccgagtacgtccta
ctcgcagtgcagtggccctggcagatccacaccgacgccggcagacggctcaccgtccac
cacgacggccgctcctgctcgatgaccgacatcgacttcgaggtcgacgaccactccccc
accggcccgttccgcttctccctcgtcagcacggcctggcgcatcccctaccaggccgac
tacgagaacaggcgcctcgtctaccgccccctgggctcggatgcgaaagtgcgcagcagc
acccgcggcacgcaggcgctgccgctgcaggcatggctgaacatccaccgtcccgaactg
ttcctggagggcgaccgcctcatcgacgacgagggccgactgctcaacccccgttacgcc
cggctccccttcgacacgagcgggttcgtaccgctggcctggcagggcgtggacctcacc
aaggagtcccaggggcccgaacgccgcccggactccatccagttccacatgtcggcgcac
ctgcgtgcatcaagcgccttcgacgtcctcatcgacgacgacggccccggcgaggctgcc
gacctcgtcggcctgcgcgtcgtcgacaacaagtacctcgacatcacactcgtgcactgc
aagtacaccaaggccgccgcaggccgccgcgtcaaggacctgtacgaggtgtgcggccag
gccgtccgcagcgccaaatggcggcgcggcaggacgctctccctcctggaccacctgcgc
gaccgcgcccagaagtacaccgcgcgcaccggcatctccccgtacgagatcggcggcccc
agggaactcctcgcgatccacgacatcgcacgcaccctcatcccccgcttccacaccgtc
gtcgtccaacccggcctccaggccgaacacgccacccacgaccaactgctcctgctcgcc
ggagcagagcagtacgtccggcacgccactgccggcgacttcgccgtgtactgcagtccc
tga

DBGET integrated database retrieval system