KEGG   Kitasatospora setae: KSE_76620tHelp
Entry
KSE_76620t        CDS       T01648                                 

Definition
(GenBank) putative transposase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve Mu-transpos_C
Motif
Other DBs
NCBI-ProteinID: BAJ33413
NITE: KSE_76620t
UniProt: E4MYX2
Position
complement(8761557..8764067)
Genome map
AA seq 836 aa AA seqDB search
MRAQRSGCTCRTGSAPGTDDDDGRCAGLEPGDTVRWHGASYLVAALQGGRVHLSAADEDG
EDAVALLSAVVGAPDFAVLDDAGTERPGARIPDVSILSLLTPAELVDVRAWERHLREAEE
GLPPGCAPDARPRPEYDPATVSRSQRLASKERELKALGWRKVSVATLDRRLKEYSAQGVA
ALVKVVAGKLYGNTDERIVALLLQELKDGVEESSGWGTRLHERLQAGLRAAYPEENLRIS
RTGFYRLLNSLGTRTGSLRGPVRRRREAAGSPEPPWTPTRARMLGEMVQIDSTGLDVLAI
GDDGYPVQVELTAAVDVASRSIIGALIVPRAPGRGYKGKRLGGRATTSFDATLMLAQALA
PMPARPGWSPLSRAELSDLPYADQVACDPRMAGAAARPVIRPKMVVVDQGKIYQGEHFED
VCTSLGISIRSARDNTGPDKAIVEATFSALKKLFSQYVAAYTARDLARRGKYVAEGPMWR
LNELQDLLNEWIALHWQQHRHEGLRSPNLPGVVLTPNQMYAALVACEGYAPLPLSPSQSR
KLLLCEWRQVGDKGVRVGNRTYNSAALQAYNKQPSGVRGQGKRWPIRFDPYAPHYVWLFD
QRQEQLGKDPWVEAEFIHQDLIDGEWSQYLWQTAEQAFLNAGGPEEHEQRERDIALAVSE
LRERARRGPLDEAPAARAWRRAGAARRLWRRPGRPFTGPQPAVRPPDPDRYASISVPDPA
TIVPARSLENPAQFLFPDQDAGPRLSGDAGVLVTAGEPVAVPDTDERPPQNAEPPADPGV
DMTTGTGKEPRLVAQRRGSTGGIADLFLSGLPAPADASDPAPPPRAAAGSTDEEDS
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
gtgagggcccagaggtccggctgcacctgccgtaccggcagcgcgccgggcacggacgac
gatgacgggcggtgcgccggcctggagccgggcgacacggtccgctggcacggcgcctcg
tacctggtggccgccctgcagggcggccgggtccacctgagcgccgccgacgaggacggc
gaggacgcggtcgcgctgctgtcggccgtcgtaggtgccccggacttcgcggtcctggac
gacgccggcacggagcggcccggagcccggatccccgacgtcagcatcctgtccctgctc
accccggctgaactggttgacgtccgcgcgtgggagcggcacctgcgcgaggcagaggaa
ggcctgccgccgggttgcgcacccgacgcgcggccccggcccgagtacgacccggccacc
gtctcccgcagccagcggttggccagcaaggagcgcgaactcaaggcgctgggctggcgc
aaggtgtcggtggcgaccttggaccggcgcttgaaggagtactcggcccagggcgtggcg
gccctggtgaaggtcgtcgccggaaagctctacgggaacaccgacgagcggatcgtcgcc
ctgctgctgcaggagctcaaagacggagtcgaggagtcctccggctggggcacccgcctg
cacgagcggctgcaggccggcctgcgcgcggcctaccccgaggagaacctgaggatctcc
cgcaccgggttctaccggctgctgaacagcctcggcacccgcacgggctccctgcgcggg
cctgtacgccgccgcagggaggcggcgggctcccccgagccgccgtggacgcccacacgg
gcacggatgctcggcgagatggtgcagatcgactcgaccggcctggatgtgcttgcgatc
ggcgacgacggctacccggtccaagtcgagctgaccgcggctgtggacgtggccagccgc
agcatcatcggggcactgatcgtgccccgcgctcctggccgtgggtacaagggcaagcgg
ctgggcggacgagcgaccacctcgttcgacgccaccctcatgctcgcgcaggcactcgcc
cccatgccggcccggcccggatggtcgccgctcagcagggctgagctgtcggatctgccc
tacgcggatcaggtcgcctgcgatccgcggatggccggtgccgcggcgcggccggtgatc
cgcccgaagatggtcgtcgtcgaccaggggaagatctaccagggcgagcacttcgaggac
gtgtgcacctcgctggggatctcgatcaggtcggcgcgggacaacaccggccccgacaag
gcgatcgtggaggcgacgttctccgccttgaagaagctgttcagccagtacgtggccgcc
tacacggcacgggacctggcccggcgcggcaagtacgtggccgaggggccgatgtggcgg
ctcaacgagctgcaggacctgctgaacgaatggatagcgctgcactggcagcagcaccgc
cacgaggggttgcgcagcccgaacctgcccggtgtggtactcacccccaaccagatgtac
gcggctctcgtggcatgcgaggggtacgcgccgctgcccttgtcgccgtcgcagtcgcgc
aagctgctgctctgcgagtggcggcaggtcggcgacaagggcgtgcgggtcggcaaccgc
acgtacaacagcgccgcgctccaggcatacaacaagcagccctccggggtgcgggggcag
ggcaagaggtggccgatccgcttcgacccgtacgcgccgcactatgtgtggctgttcgac
cagcgccaggagcagctcggcaaggacccgtgggtggaggccgagttcatccaccaggac
ctgatcgacggcgagtggtcccagtacctgtggcagaccgcggagcaggccttcctcaat
gcgggcggcccggaggagcacgagcagcgggagcgcgacatcgccttggccgtgtcggag
ttgcgggagcgggcgcggcgcgggccgctcgacgaggcacccgccgcacgggcctggcgg
cgggcgggcgcagctcggcggctgtggcgccggccgggccggccgttcaccgggcctcag
ccggcggtgcgcccgccggatccggacaggtacgccagcatcagtgtccccgacccggcc
acgatcgtgccggcccgctcgttggagaatcccgcgcagttcctcttccctgatcaggac
gccgggccgcggctgtccggcgacgcgggcgtgctggtgactgcgggcgagccggtcgct
gttcccgacacggacgagcgtccgccgcagaacgcagaaccgccggcggatcccggagtg
gacatgacgactgggactgggaaggagccgcggctggtggcacagcggcgcggttccacg
ggtggcatcgccgatctgttcctcagcggcctgccagccccggccgatgcctccgatcct
gctcccccgccccgggcagcggccggctccaccgacgaggaggattcgtga

DBGET integrated database retrieval system