KEGG   Kitasatospora setae: KSE_76680tHelp
Entry
KSE_76680t        CDS       T01648                                 

Definition
(GenBank) putative helicase
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C_2 UvrD_C AAA_30
Motif
Other DBs
NCBI-ProteinID: BAJ33419
NITE: KSE_76680t
UniProt: E4MYW6
Position
complement(8772362..8774773)
Genome map
AA seq 803 aa AA seqDB search
MPTAEQQAAREMFAAGGDLALVAGAGTGKTSTLVLMGQSTPRRGLYVAFNKSIADDAKSR
FGSNVECRTAHSLAFQSVGRNYRERISRSARVPAWQTARRLGIDRDLPVNSTRITVKHQA
RLVMGMVRRFCYTTDRQLMARHLEWVNGLDTGGQDFVARELLPYAARAWEDLQDPGGELR
FEHDHYMKMWALTSPVLGADFVLLDEAQDTNPVLEEVFLNQKAQRVCVGDPAQQIYAWRA
AKDVMTAFPAEHLELTQSFRFGPGIAAVANRWLCHAESPMRLAGCGPESRIGPVVGADAV
LCRTNADALREVIGFLDDGVPVALAGGGAAMERIAQAALELKAGKRTSHPELFLFSSWGE
VQEYVEQDSAGSDLKAIVQLVDTHGPEAILAAAQRLTPEEQAKVTVSTAHKAKGREWDTV
RIAGGFEAPPLDEDGLQAPLSLPEARLAYVAVTRACRHLDMESMAWLDAYEKTLASGPGA
GGRPLLDLSLTGQLKHLASPMSRFMEQHLPDARHVAGDYLKRLPPLPRPVQPLDVAHPKF
DALGHAIDYRLRLSLGRDMGGAVAAGVDAMHPRWELPGAPAPKVRSALHTAGVELLDLTR
RHLDSEGTYLDEDTLSRLCFVAASYEDIYRIGRVHRFSFLTRADEHTTLRRLTDAVDSYV
PDDLAVQMRLAQEPFAALRALPEAQRVCGPVFAGSGDIGGADADFVLGGLLIDCKATTRP
RQLGVAEIYQLAGYLLLDYDDEFGIDRVGLYLSRQGHLITWTVPDFLLRLGTTTPLPTLR
HRLRDFLHTEAAALASPIGNRVR
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgccgagcagcaggcggcccgtgagatgttcgccgccggcggcgatctggcc
ctggtggccggtgccgggacgggaaagacgtccaccctggtcctgatgggacagtcgacg
ccgcgtcggggcctgtacgtggcgttcaacaagtcgatcgccgacgacgcgaagagccgg
ttcgggtcgaacgtcgagtgccgcacggcgcactcgctggcgttccagagcgtggggcgc
aactaccgtgaacggatcagccgttcggcacgcgtgccggcctggcagaccgcgcgccgg
ctcgggatcgaccgggacctgccggtgaactccaccaggatcaccgtcaagcaccaggcc
cgcctggtgatggggatggtgcgccggttctgctacaccaccgaccgtcagctgatggcc
cgtcacctggaatgggtcaacggcctggacaccggcgggcaggacttcgtcgcccgcgag
ctcctgccgtacgcggcgcgggcgtgggaggacctccaggacccgggaggggagctgcgg
ttcgagcacgaccactacatgaagatgtgggctctgacctcgcctgtgctgggtgcggac
ttcgtgctcctggacgaggcccaggacaccaaccccgtgctggaggaggtcttcctcaac
cagaaggcgcagcgggtatgcgtgggtgatcccgcacagcagatctacgcctggcgggcg
gcgaaggacgtgatgaccgcgttccccgccgaacacctggagctcacacagtcgttccgc
ttcggcccggggatcgcggccgtggccaaccggtggctctgccatgcggagtccccgatg
cgcctggccggttgcggtcccgaatcgaggatcggcccggtggtgggagccgacgcggtg
ctgtgccgcaccaatgccgacgctctgcgggaggtgatcggtttcctcgacgacggcgtg
ccggtcgcgctcgccggcggcggtgcggcaatggagcggatcgcgcaggccgcgctggag
ctcaaggccggcaagcgcaccagccatccggagctgttcctgttctcctcctggggcgag
gtgcaggagtacgtcgagcaggacagcgccggctccgacctcaaggcgatcgtgcaactc
gtcgacacgcacggccccgaggcgatcctcgccgctgcccagcgtcttacccccgaggag
caggcgaaggtgacggtgtcgaccgcgcacaaggccaagggccgtgagtgggacaccgtg
cggatcgcgggcgggttcgaggcgccgcccctcgacgaggacggactgcaggccccgctg
tccctgcccgaggcgcggctggcctacgtcgccgtcacccgcgcctgccgtcacctggac
atggaatccatggcctggctcgatgcctacgagaagaccctcgcctccgggcccggcgcg
ggcgggcggcccctgctcgacctcagtctcaccgggcagctcaagcacctcgcctccccc
atgtcccggttcatggagcagcacctgcccgacgcccgccacgtcgccggcgactacctg
aagcggctgcccccgcttccccgtcccgtacagcccctggatgtcgcccacccgaagttc
gacgccctcggccacgccatcgactaccggctgcgcctgtccctcggccgggacatggga
ggcgctgttgcggccggtgtcgatgccatgcacccgcgctgggagctgcccggagcgcct
gccccgaaggtccgcagcgccctgcacaccgccggagtcgaactcctcgacctcacccgg
cgccacctcgacagcgaaggcacctacctggacgaggacacgctctcacggctgtgcttc
gtcgccgcctcttatgaggacatctaccgcatcgggcgggtgcatcgcttcagcttcctc
acccgggccgacgaacacaccaccctgcgccgcctcaccgacgcggtcgacagctacgtg
cccgacgacctcgccgtacagatgcgtctcgcccaggagccgttcgccgcgctgcgggca
ctgcccgaggcgcagcgggtgtgcgggccggtgttcgccggcagtggcgacatcggcggc
gcggacgccgacttcgtcctcggcggactgctgatcgactgcaaggccaccacccggccc
cgccagctcggcgtcgcggagatctaccagctcgccggctacctgctcctggactacgac
gacgagttcggcatcgaccgcgtcgggctgtacctgtcccgccaaggccacctcatcacc
tggaccgtccccgacttcctgctccgcctcggcaccaccacacccctgcccaccctgcgg
cacaggctccgcgacttcctgcacaccgaagcagccgctctggccagccccatcggcaac
cgcgtgcgctga

DBGET integrated database retrieval system