KEGG   Kitasatospora setae: KSE_76710tHelp
Entry
KSE_76710t        CDS       T01648                                 

Definition
(GenBank) hypothetical protein
Organism
ksk  Kitasatospora setae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ33421
NITE: KSE_76710t
UniProt: E4MYW4
Position
8777560..8778315
Genome map
AA seq 251 aa AA seqDB search
MGAWAWTALFAAAAVLAALVWWTNRYPGGWRFAFHRQHADDRARLRTKRGNLRRLEHEAA
DRLAALRAAVDTERSAYRSRIARAERRLAMLRDPGRGTLHSTMGPVQLYEHRLVVSTGGA
THEYPLEEIAVRCERADDIGHLHLVLPDGRQQALDFPEEEYDPTELTQFAARTHDAIAAA
KRATPLRLANIPQAEAELAEAVADTTRHEQALERLEQGKAEQAADTKIPTARRALDEELD
RWHKITGARPR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggggcctgggcctggacagccctgttcgcagcggcggcggtgttggccgcgctcgtg
tggtggacgaaccgctaccccgggggatggcggttcgcgttccaccgccagcacgccgac
gaccgagcccgcctccgtaccaagcggggcaacctgcgccggctggaacacgaggccgca
gaccggctcgcagccctccgagccgccgtcgacacggaacgctccgcctaccgcagccgc
atcgcccgagccgagcgccgtctcgcaatgctccgtgaccccggccgcggcacactgcac
agcacgatgggccccgtgcagctgtacgagcaccgactggttgtctctaccggcggggcg
acccacgagtacccactggaggagatcgcggtccgctgcgagcgagccgacgacatcgga
cacctgcacctggttcttcccgacggccgacagcaggcactcgacttccccgaggaagag
tacgacccgacggaactcacgcagttcgccgccaggacgcacgacgccatagccgctgcc
aaacgggccacaccactccgcttggccaacatcccccaagcggaagccgaactcgccgaa
gccgtcgccgacaccacccgccacgagcaggcactcgaacggctggaacagggaaaggcc
gaacaagcagccgacacgaagatccccaccgcccgccgagccctggacgaagagctggac
cgctggcacaagatcaccggagcccgtccgcgctga

DBGET integrated database retrieval system