KEGG   Candidatus Kuenenia stuttgartiensis: KSMBR1_1293Help
Entry
KSMBR1_1293       CDS       T05435                                 

Gene name
murI
Definition
(GenBank) hypothetical protein
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
kst  Candidatus Kuenenia stuttgartiensis
Pathway
kst00471  D-Glutamine and D-glutamate metabolism
kst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KSMBR1_1293 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kst01011]
    KSMBR1_1293 (murI)
Enzymes [BR:kst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     KSMBR1_1293 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:kst01011]
 Precursor biosynthesis
  Racemase
   KSMBR1_1293 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: SOH03795
UniProt: A0A2C9CDR9
Position
MBR1:1398260..1399060
Genome map
AA seq 266 aa AA seqDB search
MTIDDPIAIFDSGVGSLSIIKEIRNALPGENYIYLADKKHFPYGKKTHDELLRIIRNTIE
YLSKNFTPKLIVLASNTPSIQVLHELKKGAVDVIGVFPPVNEAVSVSKTGHIAILATQNT
VMSSELDEYIHSQKIPASAKIIKWNASRMVELVETGDFLSNKDKSLRIISEELSLLEETD
NMVDTITLSSTHLPFLNEYFALLRPCLHLIDPAKIVARKVKSLLERNLRTTSQKGTLEIL
ATQGKESLETIIKRLGIQEEIHEVRF
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgacgacccaatagcaatatttgattcaggggtggggagcctttcaataata
aaggaaatcagaaatgccttgcccggcgagaattatatctacctcgcagataaaaaacat
tttccttatggaaaaaaaacacacgatgaattgttacgcattatccggaacaccatagag
tatctttcgaaaaatttcaccccaaaactcattgtgcttgcctccaacacgccttccatt
caggtgcttcatgaattgaaaaaaggggcggttgacgttatcggcgtatttcctccggtc
aatgaagctgtaagtgtctccaaaacaggacacatcgccattttggcaacgcaaaacacg
gtaatgagttccgaactggacgagtacatacactcgcagaagattccggcatcggcaaaa
atcataaagtggaatgcctcacggatggtagagcttgtggaaacgggagattttttgtca
aataaggataaaagcctcagaataatctccgaagagctttcactgttggaagagacggat
aacatggtcgacacaattacactttcaagcacacaccttccttttttaaatgaatatttt
gcgctgctaaggccctgccttcatttaattgaccccgcaaagattgttgccagaaaagta
aaaagtctgctggaaagaaatcttcgtactacgtcacaaaaaggaaccctggaaatattg
gccacgcagggaaaagaatcactcgaaacaatcataaaaaggcttggcatccaagaggaa
atacacgaggtacggttttag

DBGET integrated database retrieval system