KEGG   Kurthia sp. 11kri321: ASO14_1650Help
Entry
ASO14_1650        CDS       T04250                                 

Gene name
acaa2
Definition
(GenBank) 3-ketoacyl-CoA thiolase, mitochondrial
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kur  Kurthia sp. 11kri321
Pathway
kur00071  Fatty acid degradation
kur00280  Valine, leucine and isoleucine degradation
kur00310  Lysine degradation
kur00362  Benzoate degradation
kur00380  Tryptophan metabolism
kur00620  Pyruvate metabolism
kur00630  Glyoxylate and dicarboxylate metabolism
kur00640  Propanoate metabolism
kur00650  Butanoate metabolism
kur00900  Terpenoid backbone biosynthesis
kur01100  Metabolic pathways
kur01110  Biosynthesis of secondary metabolites
kur01120  Microbial metabolism in diverse environments
kur01130  Biosynthesis of antibiotics
kur01200  Carbon metabolism
kur01212  Fatty acid metabolism
kur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASO14_1650 (acaa2)
   00630 Glyoxylate and dicarboxylate metabolism
    ASO14_1650 (acaa2)
   00640 Propanoate metabolism
    ASO14_1650 (acaa2)
   00650 Butanoate metabolism
    ASO14_1650 (acaa2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ASO14_1650 (acaa2)
   00072 Synthesis and degradation of ketone bodies
    ASO14_1650 (acaa2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASO14_1650 (acaa2)
   00310 Lysine degradation
    ASO14_1650 (acaa2)
   00380 Tryptophan metabolism
    ASO14_1650 (acaa2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ASO14_1650 (acaa2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ASO14_1650 (acaa2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ASO14_1650 (acaa2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kur04147]
    ASO14_1650 (acaa2)
Enzymes [BR:kur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ASO14_1650 (acaa2)
Exosome [BR:kur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASO14_1650 (acaa2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMA62202
UniProt: A0A0X9VPL3
Position
complement(1577727..1578908)
Genome map
AA seq 393 aa AA seqDB search
MEDVYLIEGARTAFTAFTGSFATVSAIQLGTVTAVEALNRSKVAPEDVDAVFYGNVIATG
KDAAYTARHIALLAGLPEEIPALTLNRLCGSGLQSVISGAQEIQLGESQIVLAGGTENMS
QAPFSNFEQRSQSSKMGNIQFEDMLQATLTDQYTGMGMGMTAENLAEKYAITREQQDAYA
VLSHERAAASQQADVFAREIVPVQVPTRKGTRVIEQDEQIRPDTTVEQMAQLQPVFKRQG
TVTAANASSINDGAASIVLASGQAVEEKGLQPLAKIISYAAVGVDPNYMGIGPVPAIKRA
LVRANLTIDDIDLFEINEAFAAQYLAVEQELQLDRNRVNVHGGAIALGHPVGASGTRVLL
SAAHTLHERQERYAVVSLCIGGGQGIAMIIERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgtgtatctaattgaaggtgcgcgaacagcctttactgcgtttacaggctct
tttgcgaccgtatcagccattcaactcggaacggtaacagctgttgaagcattgaatcgc
tcgaaagttgcaccagaagatgttgatgctgtattttacgggaatgtcattgcgacaggt
aaagatgcagcttatacagcgcgtcatattgcgttacttgcaggattaccagaagaaata
cctgctctcacattgaatcgattatgtggttcaggattacaatctgttatttcaggcgca
caggagattcaacttggtgaatcacaaatcgttttagcaggtggcacagaaaatatgtca
caagctccattttcaaattttgaacagcgcagtcaatcatcaaaaatggggaatattcaa
tttgaagatatgctacaagctactttaaccgatcaatacacaggcatgggtatgggcatg
acagctgaaaatttagctgaaaaatatgcgattacgcgagaacaacaagatgcctatgcg
gtattatcacatgaacgtgcagcagcctcacaacaagcagatgtattcgcacgtgagatt
gtgcctgttcaagtgccaacacgtaaaggaacacgcgtaattgagcaagatgaacaaatt
cgtccagatacaaccgttgaacagatggcacagctccaacctgttttcaaacgccaaggt
actgttacagcagcaaacgcctcaagtattaatgacggtgcagcttcaatcgtacttgca
agtgggcaagctgtagaagaaaaaggattacaaccactcgcaaaaatcatttcgtatgct
gctgttggcgtggatccgaactacatgggaattggtcctgtacccgcgattaaacgcgct
ttagtacgtgcaaatttaacaatagatgatattgacttatttgagattaatgaagctttt
gcagcacaatatttagcagttgaacaagagctacaactagaccgtaatcgtgtgaatgta
catggaggagcaattgcacttgggcatcctgttggtgcaagtggtacacgtgtattattg
agtgcagcacatacattgcatgaaagacaggaacgctatgcagttgtaagcctttgcatt
ggcggaggtcaaggaattgcgatgattattgagcgcgtatag

DBGET integrated database retrieval system