KEGG   Kurthia sp. 11kri321: ASO14_2330Help
Entry
ASO14_2330        CDS       T04250                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
kur  Kurthia sp. 11kri321
Brite
KEGG Orthology (KO) [BR:kur00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ASO14_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Crystall_3
Motif
Other DBs
NCBI-ProteinID: AMA63480
UniProt: A0A0X1RYB8
Position
complement(2282184..2283182)
Genome map
AA seq 332 aa AA seqDB search
MDTIVILTILVVIFALAFDFINGFHDTANAIATSVSTRALKPKTAVLMAAIMNFVGAITF
VGVAKAITKDIVDPFTLGNGTLVILAALISAIAWNLITWYFGIPSSSSHAIIGSIAGAAV
AAGGWAILNYEGFIKILQALILSPFIAITVGFLVMSLFKILFKNFNLYKTNKGFRSVQIG
TAALQAFTHGTNDAQKAMGIITMALIAAGWQTTDEVQGWVRFACALAMGLGTSIGGYKII
KTVGGKIMKIRPVNGVAADLSSASIIFGATLIHLPVSTTHVISSAIMGVGAAQRVKGVKW
GVARKIVLTWIITLPISALFAGVVYFILDMFF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacaattgttattttaaccatactcgttgtcatctttgcattagcatttgatttt
attaatggtttccatgatacagcgaatgcgattgcgacatctgtctcgacgcgtgcttta
aaaccaaaaacagctgtattaatggctgcaattatgaactttgttggtgcgattactttc
gtaggggtagccaaagcgattaccaaagatattgtcgatccatttactttagggaatggt
acacttgttattttagcagcgcttatctcagcgattgcttggaacttaattacatggtac
ttcggtatcccatcaagttcttcacatgcaattatcggttcgattgcaggggcagcagtt
gcagctggtggttgggcaattttaaactatgaaggatttattaaaatccttcaagcatta
attctatcaccattcattgcaattacagtcggtttccttgtgatgagtctatttaaaatt
ttgtttaaaaactttaatctgtataaaacaaataaaggcttccgttctgttcaaattggt
acagcggctttacaagcattcacacatggtacgaatgatgcgcaaaaagcaatgggtatt
atcacaatggctttaattgcagctggttggcaaacaacagatgaagtacaaggttgggtt
cgttttgcctgtgctttagcaatgggtctaggtacatcaattggtggttataaaattatt
aaaacagttggtggtaagatcatgaaaattcgtccagtaaatggtgtagcagctgactta
tcttctgcttcaatcatctttggtgcgacattaattcacttaccagtatcaacaacacat
gttatttcttctgcaatcatgggtgttggtgcagcgcaacgtgtaaaaggtgttaaatgg
ggtgtagcacgtaaaattgttttaacgtggattattacgttaccaatttcagcactattt
gcaggcgtagtttattttatattagacatgttcttctaa

DBGET integrated database retrieval system