KEGG   Kurthia sp. 11kri321: ASO14_2727Help
Entry
ASO14_2727        CDS       T04250                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kur  Kurthia sp. 11kri321
Pathway
kur00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ASO14_2727
Enzymes [BR:kur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ASO14_2727
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ASO14_2727
    1.1.1.-  
     ASO14_2727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc UDPG_MGDP_dh_N 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AMA61853
UniProt: A0A120HPI8
Position
complement(2693772..2694821)
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGVKDIRVEEKELRELRDHEVTVRVAWAGICGSDLHEYEEGPVFVPVDAPNDLT
GEVAPITMGHEFSGVVEAVGKHVTKYKVGDRVVVNPTLTYGKKHEELDIYDGFSFIGLSG
DGGFAHFANVPEANVYALPESLTLQDGALVEPMAVAVQAVKEADMRFGDTVAVFGVGPIG
LLTIIAAKAAGASKILAFDLSDERLNKAKELGATHIFNSGKVKPVEAVRKEVPDGVDVTF
EVAGVGPTFQSAIEVTRARGTMVIVSIFARPIEWNPMMLTNTGVKVTSTIAYSPTSFQQT
IDLMGTGQIKPQGIITSQIHLEEIVASGFEALTNDKTQAKILVELSGEF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggtgtgaaagatattcgtgtagaagaaaaagaactaaga
gaattacgtgaccatgaagtaacggttcgcgttgcatgggcaggtatttgtggttcagat
ttacatgagtatgaagaaggccctgtttttgttcctgttgatgcaccaaatgatttaact
ggtgaagtcgctccaattacgatgggacatgaattttcaggtgtagtagaagcagtcgga
aaacatgtaacgaagtataaagtcggtgatcgtgttgttgtgaatcctactttaacatat
ggtaaaaaacatgaagaattagatatttatgatggttttagctttattggattaagtggt
gatggtggatttgcacattttgcaaatgtaccagaagcaaatgtatatgccttacctgag
tcattaactttacaagatggtgcattggttgaaccgatggctgttgctgtacaagctgta
aaagaagctgatatgcgttttggtgatacagtcgctgtatttggtgtaggtccaatcggt
ttattaacaatcattgcagcaaaagcagctggcgcaagtaaaattttagcttttgattta
tcagatgaaagactaaataaagcaaaagaattaggtgcaacccatatctttaattcaggt
aaagtaaagccagttgaagctgttcgaaaagaagtgccagatggtgttgatgtaacattt
gaagtagcaggtgtaggaccaacattccagtcggctattgaagtaacaagagcgcgtggt
acgatggttattgtatcgatttttgctcgtccaattgaatggaacccaatgatgttgaca
aatacaggtgtaaaagtaacttctacaattgcttattcaccaacttcgttccaacaaaca
attgatttaatgggaacgggacaaattaaacctcaagggattattacgtcacaaattcat
ttagaagaaattgttgcttctggatttgaagcattaacaaatgataaaacgcaggctaaa
attcttgtagaattaagtggagaattttaa

DBGET integrated database retrieval system