KEGG   Kurthia sp. 11kri321: ASO14_643Help
Entry
ASO14_643         CDS       T04250                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kur  Kurthia sp. 11kri321
Pathway
kur00480  Glutathione metabolism
kur00590  Arachidonic acid metabolism
kur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ASO14_643
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ASO14_643
Enzymes [BR:kur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ASO14_643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: AMA62769
UniProt: A0A0X1RW84
Position
complement(612236..612781)
Genome map
AA seq 181 aa AA seqDB search
MSIYNYLVKKPNGEILSMETYRGKTMLIVNSASQCMFTYQYEDLQKLYAKYKNRDFIVLA
FPTNQFGEQNPEDGVTTMTTCKTHFGVEYPIFDLIEVNGERTAPLFNYLKHEVDVRDVDQ
TNMQEMMVMDRVKRDYPDYLIGRNIRWNFTKFLVDANGQVISRFEPTDSLLDLEQAIEKV
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttataattatttagtaaagaaaccaaacggtgaaattttatcgatggaaact
tatcgtggaaaaacaatgttaatcgttaattccgcaagtcagtgtatgtttacatatcaa
tatgaagacttacaaaagctctatgcaaaatataaaaatcgcgacttcattgtactcgca
ttcccaacgaatcagttcggtgaacaaaaccctgaagatggtgtcacaacgatgacgaca
tgtaaaactcactttggcgtggagtatcctatatttgatttaattgaagtaaatggtgaa
cgcactgctccattattcaattacttaaaacacgaagtcgatgtacgcgatgtcgatcaa
acgaatatgcaagagatgatggtcatggaccgtgtaaagcgtgattacccagactattta
atcggacgtaatattcgctggaacttcacaaaattcttagtcgatgcgaatggtcaagta
atttcacgcttcgaaccaactgattcactccttgatttagaacaagcaattgaaaaagta
ttgtaa

DBGET integrated database retrieval system