KEGG   Kushneria konosiri: B9G99_01140Help
Entry
B9G99_01140       CDS       T04839                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
kus  Kushneria konosiri
Pathway
kus00564  Glycerophospholipid metabolism
kus01100  Metabolic pathways
kus01110  Biosynthesis of secondary metabolites
Module
kus_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B9G99_01140
Enzymes [BR:kus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     B9G99_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ARS51663
UniProt: A0A2Z2H3A2
Position
224606..225484
Genome map
AA seq 292 aa AA seqDB search
MNRDRLFALLQYPLPQHAISRLAGQLADARTPWIRDTFIQRFASHYDIDMSEALEPDLGA
YKSFNDFFTRALKPDARPIDSGIVSPADGVLSQFGRIDHGTLMQAKGHAYSLTALLGGDD
AAAAELRDGSFATVYLSPRDYHRVHMPLEGRLIRTIYVPGRLFSVNQATAREVPGLFARN
ERLVCLFETELGPMALVLVGAMIVAGIETVWSGQVTPLSRQPHSNDWARGDITLGKGDEM
GRFHLGSSVVMCLPKAYSFVDTLTPGMKIRLGQQLAPDPDIPADTLTPEELS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcgcgatcgtctgtttgccctgctgcaatatccgctgccccagcacgccatttcc
cgactggcaggacagcttgccgatgcgcgcacgccctggatcagggatacgttcattcag
cgctttgccagtcactacgatatcgacatgagtgaagcgcttgaacccgatctcggcgcg
tacaagagtttcaacgacttttttacccgtgccctcaagcctgatgcccgccccatcgac
tccgggatcgtttcgcctgctgacggtgtgctctcgcagttcggacgcatcgatcatggc
accttgatgcaggccaagggccatgcctactcgctgacggccctgctgggcggtgatgat
gctgcggccgccgagctgcgcgatggcagtttcgccaccgtctatctctcgccgcgagac
taccaccgcgtgcacatgccactcgaaggacgcctgattcgcaccatctacgtgcccgga
aggctcttttccgtcaaccaggcgaccgctcgtgaagtgccggggcttttcgcccgcaac
gaacggctggtctgcctgtttgaaaccgaactggggccgatggcactggtgctggtgggt
gcgatgattgtggccggcatcgaaaccgtctggtcgggtcaggtcaccccgctgtcgcgc
caaccgcacagcaatgactgggccagaggcgacatcacccttggcaagggcgatgaaatg
ggccgttttcacctcggctcttctgttgtcatgtgcctgccaaaggcctactccttcgtt
gataccctcacccccggcatgaagattcgcctgggtcagcagctggcacctgatcccgac
attcccgccgacacgctcacaccggaagagctttcctga

DBGET integrated database retrieval system