KEGG   Kushneria konosiri: B9G99_01635Help
Entry
B9G99_01635       CDS       T04839                                 

Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
kus  Kushneria konosiri
Pathway
kus00020  Citrate cycle (TCA cycle)
kus00620  Pyruvate metabolism
kus01100  Metabolic pathways
kus01110  Biosynthesis of secondary metabolites
kus01120  Microbial metabolism in diverse environments
kus01130  Biosynthesis of antibiotics
kus01200  Carbon metabolism
Module
kus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B9G99_01635
   00620 Pyruvate metabolism
    B9G99_01635
Enzymes [BR:kus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     B9G99_01635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: ARS51754
UniProt: A0A2Z2H3K6
Position
336796..338490
Genome map
AA seq 564 aa AA seqDB search
MKKHLTAALCMNLCMASGYALASEKSASTGNDDTVDVVMVGGGIMSAVLGTYLEELQPDW
TVNLYERQDNVAEESSNGWNNAGTGHSAFCEMNYTPQLEDGSVDVSRPPKITEAFEITRQ
FLSYQILNGVMHDPSSFINNTPHVSFVWGDDNVDFLRKRYEGMKQNAFYDAMEYTEDPDT
LRQWVPAMMAGRDSAQHVAATYMNAGTDANWGEVTRQLIDSLDQHHENFHLSLESEVRGL
DRNDDGTWKVTIADLANGGREHSVNARRVFIGAGGAALPLLQESGIPEAEQYAGFPVGGQ
FLVTSNPEVVARHDVKAYGLAAEGSPPMSVPHLDRRMLDGQPRLLFGPFATFSTKFLKEG
SWTDLFGSLTMHNTLPMMQVGMDNFNLVQYLVGQVIQSEDDRFEALKAYFPEAKRDDWEL
ITAGQRVQIIKDKDDQGGVLQFGTEVVASEDGTMSALLGASPGASTSPTIMLGLMEKIFP
QELASEAWKAKLNRIIPSYGQSLNGNPEMINAVRAYTSSVLELEDTQPRGDNAQRVETFR
QRALSQEAGQAQDHSEESDSTDHV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacatttaacagcggcgctgtgcatgaacctgtgcatggcctcaggctacgcg
ctggcttccgagaagagtgcctcgaccggtaatgacgacaccgtggatgtggtcatggtc
ggtggtggcatcatgagcgccgtgctgggaacctatctggaagagctccagcccgattgg
acggtcaatctgtatgagcgccaggacaatgtggccgaagaaagctccaatggctggaac
aatgccggcaccgggcactctgccttttgcgagatgaattacaccccgcagcttgaagat
ggcagcgtggacgtttcgcggccgcccaaaattaccgaagcctttgagattactcgtcag
tttctgtcctatcagattctcaatggcgtcatgcatgacccctcctcctttatcaataac
acccctcatgtcagctttgtatggggtgacgacaacgttgacttcctgcgcaagcgctat
gaaggcatgaagcagaacgccttctatgatgccatggaatacaccgaagacccggacacc
ctgcgccagtgggtaccggccatgatggccggacgcgacagcgcccagcacgtcgccgcc
acctacatgaatgccggtacggatgccaactggggcgaggtaacgcgtcagctgatcgac
tcactggatcagcatcatgagaacttccacctgtcgcttgaaagcgaagttcgcggtctg
gatcgcaacgatgacggcacctggaaggtcaccatcgccgatctcgccaacggcggtcgt
gaacatagcgtcaatgcgcgccgcgtcttcattggtgcaggtggtgcagccctgccgctg
ctgcaggaatcaggcattcctgaagccgagcagtacgccggcttcccggtaggcggccag
tttctggtaaccagcaaccccgaagtggtcgcacgccatgacgtcaaggcctatggactg
gcggcagaaggctcccccccgatgtcggtaccgcacctggaccgtcgtatgctggatggc
cagccgcgtctgctgttcggcccctttgccacgttctcgaccaaattcctgaaggaaggc
tcgtggacggacctgtttggctcactgacgatgcacaacaccctgcccatgatgcaggtc
ggaatggataactttaatctggtgcagtatctggtcggccaggtcattcaatccgaagat
gatcgttttgaagccctcaaggcctacttccccgaagccaagcgcgatgactgggaactg
atcaccgccggccagcgcgttcagatcatcaaggacaaggacgaccagggcggcgtactg
cagtttggtaccgaagtcgtggcctcagaagacggcaccatgtcggcactgctgggcgca
tctccgggagcttccacatcgccgaccatcatgctgggcctgatggagaagatcttcccg
caggagctggcctccgaggcatggaaagcgaagctcaatcgcatcattccgtcctacgga
cagtcgctcaacggcaatcccgagatgatcaatgccgtgcgcgcctacaccagtagcgtt
ctcgagcttgaggatacccagcccagaggcgacaacgcccagcgcgttgaaacgttccgt
cagcgggcgctgagtcaggaagccgggcaggcgcaggatcattcggaagagagcgattcg
acagaccacgtctga

DBGET integrated database retrieval system