KEGG   Kushneria konosiri: B9G99_02360Help
Entry
B9G99_02360       CDS       T04839                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
kus  Kushneria konosiri
Pathway
kus00030  Pentose phosphate pathway
kus00480  Glutathione metabolism
kus01100  Metabolic pathways
kus01110  Biosynthesis of secondary metabolites
kus01120  Microbial metabolism in diverse environments
kus01130  Biosynthesis of antibiotics
kus01200  Carbon metabolism
Module
kus_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kus_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
kus_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B9G99_02360
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B9G99_02360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kus04147]
    B9G99_02360
Enzymes [BR:kus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     B9G99_02360
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     B9G99_02360
Exosome [BR:kus04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   B9G99_02360
  Exosomal proteins of colorectal cancer cells
   B9G99_02360
  Exosomal proteins of bladder cancer cells
   B9G99_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ARS51879
UniProt: A0A2Z2H3S5
Position
498704..500302
Genome map
AA seq 532 aa AA seqDB search
MTQSDHQHQQDGQQQKAPPPADNTTMFIFGASGDLVKRLLVPSLYNLDRDGLLDRSMSIV
GVDIAEHDDDSFRGHLKDFIADKAADRHAEGGGQELDEDHWQDFAQRLHYLQGDFTESDI
FEQIKSHLGQADSDNALFYCATAPRFFGDIATGLGKADLMKEGDNRYRRLVVEKPFGHDL
ESAKALNAQLLEVMKEEQIYRIDHFLGKETVQNILVARFANVLFEPFWNNHYIDHIQITT
AETVGVEKRGNFYEKSGAMRDMVPNHLFQLLAMVAIEPPAAFGADALRSEKAKVLGALRP
WPREEVHHNSVRGQYRAGNVNDSDVVGYRDEPDVAEDSNTETFVAMKMMVDNWRWVNVPF
YLRTGKRLSARDTEIAICFKPAPYAQFRGTDVERMNSNWLIIQLQPNEGMWFDFQAKRPG
PELEMDTVKMGFAYKDFFDLPAATGYETLIYDCLTGDQMLFQRVDTIENSWRAVQPFLDA
WAEDSSVEGYEAGSEGPQGAHDLLERDGRQWHKIGEVTGPGVAPVPGSSRRK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacccagagcgaccatcagcatcaacaggacgggcagcaacaaaaggcgcccccaccg
gccgacaacaccaccatgttcatctttggcgccagtggcgatctggtgaagcgcctgctg
gtcccctcgctgtacaacctggaccgcgatggtctgctcgatcgcagtatgagcattgtc
ggcgtcgatatcgccgagcacgatgacgacagctttcgcgggcatctcaaggactttatc
gccgacaaggctgccgacaggcatgccgagggaggcggtcaggaacttgacgaggaccac
tggcaggattttgcccagcgccttcactatctacagggcgatttcactgaatcggacatt
tttgagcagatcaaaagccatctcggacaggctgacagcgacaacgccctgttctactgc
gccaccgccccgcgctttttcggcgacatcgccaccggtcttggcaaggccgacctgatg
aaggaaggcgacaaccgctaccgccgcctggtggtggaaaagccctttggacatgatctg
gaatcggcgaaagcgctcaatgcgcagctgctggaggtcatgaaggaagagcagatctat
cggatcgatcactttctgggcaaggagaccgtgcagaacattctggtcgcccgctttgcc
aacgtgctgttcgagcccttctggaacaatcactacatcgatcatatccagatcacgact
gccgaaaccgtcggcgtcgaaaagcgcggcaatttttatgaaaaaagcggtgccatgcgc
gacatggtgcccaaccacctctttcagctgctggccatggtggccatcgagccgccggcc
gccttcggcgccgacgccctgcgcagcgaaaaggccaaggtgctgggcgccctgcgcccc
tggcccagagaagaagtacatcacaactcggtacgcggtcagtaccgtgccggcaacgtc
aatgacagcgacgtggtcggctatcgtgatgagcccgatgtcgccgaagacagcaacacc
gagacctttgtcgccatgaagatgatggtcgacaactggcgctgggtaaacgtgcccttc
tatctgcgcaccggcaagcgcctgagcgcacgcgataccgagatcgccatctgcttcaag
ccggcaccctatgcccagtttcgcggcactgacgttgagcgcatgaactccaactggttg
atcattcagcttcagcccaatgaaggcatgtggttcgattttcaggccaagcgtccgggg
ccggagcttgaaatggataccgtcaagatgggctttgcctacaaggacttcttcgacctg
ccggcagcgaccggctatgaaaccctgatctatgactgcctgacgggcgatcagatgctg
tttcagcgtgtcgatacgatcgagaacagctggcgcgccgtgcagcccttccttgatgcc
tgggccgaggacagcagcgtcgagggctacgaagcaggctctgaaggcccacagggcgca
catgacctgcttgagcgcgacggccgacagtggcacaagatcggcgaggtcaccggcccg
ggggtcgcaccggtgccgggcagttcacgacgaaaatag

DBGET integrated database retrieval system