KEGG   Kushneria konosiri: B9G99_04485Help
Entry
B9G99_04485       CDS       T04839                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kus  Kushneria konosiri
Pathway
kus00071  Fatty acid degradation
kus00072  Synthesis and degradation of ketone bodies
kus00280  Valine, leucine and isoleucine degradation
kus00310  Lysine degradation
kus00362  Benzoate degradation
kus00380  Tryptophan metabolism
kus00620  Pyruvate metabolism
kus00630  Glyoxylate and dicarboxylate metabolism
kus00640  Propanoate metabolism
kus00650  Butanoate metabolism
kus00900  Terpenoid backbone biosynthesis
kus01100  Metabolic pathways
kus01110  Biosynthesis of secondary metabolites
kus01120  Microbial metabolism in diverse environments
kus01130  Biosynthesis of antibiotics
kus01200  Carbon metabolism
kus01212  Fatty acid metabolism
kus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B9G99_04485
   00630 Glyoxylate and dicarboxylate metabolism
    B9G99_04485
   00640 Propanoate metabolism
    B9G99_04485
   00650 Butanoate metabolism
    B9G99_04485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B9G99_04485
   00072 Synthesis and degradation of ketone bodies
    B9G99_04485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B9G99_04485
   00310 Lysine degradation
    B9G99_04485
   00380 Tryptophan metabolism
    B9G99_04485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B9G99_04485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B9G99_04485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B9G99_04485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kus04147]
    B9G99_04485
Enzymes [BR:kus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B9G99_04485
Exosome [BR:kus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B9G99_04485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARS52227
Position
complement(951835..953010)
Genome map
AA seq 391 aa AA seqDB search
MREVVIVGTGRTAIGAFQGALSTVPAAKLGAAVIRGVLGNVDPASVDEVIMGHVLRAGAG
QNTARQAAIHAGLPEAVPAMTIDRVCGSGLSAVTMAARAIRCGDADIVVAGGMENMSLAP
YVLPKARTGLRMGHAELLDSLLHDGLWDAFNDYHMGITAENLAERYGITRQAQDDLAVES
QRRACAAREAGRFEAEIIPVEVSGRRGETTTVDQDEQPRDSVTAESLSRLKPAFTRDGTV
TAGNASTLNDGAAAVLVMSRERAEALGLPIMATIRGYGEAAVDPAFMGIGPVPATQRCLE
RARWSVGDLELIEANEAFAAQALAVQQQMGWSLERVNVNGGAIALGHPIGASGARILVSL
IHEMGRREARRGLATLCVGGGQGVAMAVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggtcgtgattgtgggcaccggacgcactgccattggtgcctttcagggcgcg
ctgtctaccgtgccggctgccaagctgggcgctgcggtcattcgtggcgtactgggaaac
gttgatccggcctcggtggatgaggtcatcatgggccacgtactgcgtgccggggccgga
cagaatacagcgcgtcaggccgccatccatgccggcctgcccgaagcggtgccggccatg
accattgaccgggtctgtggctcaggcctcagtgccgtgacgatggcagcgcgtgccatt
cgctgtggtgatgccgacatcgtggtggccggcggcatggagaacatgagtctggcaccg
tatgtgctgcccaaagcccgcacgggactgcgcatgggtcatgccgagctgctggatagc
ctgttgcatgacggcctgtgggatgccttcaatgactatcacatggggatcaccgcggag
aatctggccgagcgttatggcattacccgtcaggcgcaggatgatcttgccgttgaatcc
cagcgtcgtgcctgtgctgcccgtgaggccgggcgcttcgaggctgaaatcatcccggtt
gaggtgtcgggccggcgtggagagaccaccaccgttgatcaggatgagcagccgcgcgac
agcgtgacggccgagtcgctgtcgcgtctgaagccggcgtttacccgtgacggtacggtc
acggccggtaatgcctccacgctcaacgatggtgccgctgccgtgctggtcatgtcacgc
gagcgtgccgaggcgctggggctgccgatcatggccaccatcaggggctacggtgaggcg
gccgtcgacccggcctttatgggcatcggaccggtaccggccacgcagcgctgtcttgag
cgcgcccggtggtcggtcggtgatcttgagctgattgaggccaatgaggcctttgccgct
caggcactggcggtacagcagcagatgggctggtcgttggagcgggtcaacgtcaatggg
ggtgccatcgcgctgggacatcccatcggcgcgtccggggcgagaattctggtcagcctg
atccatgaaatgggccgccgcgaggcccgtcgtggtctggccacgctctgtgtgggtggc
ggtcagggggtggccatggccgtagagcggccctga

DBGET integrated database retrieval system