KEGG   Kushneria konosiri: B9G99_11330Help
Entry
B9G99_11330       CDS       T04839                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
kus  Kushneria konosiri
Brite
KEGG Orthology (KO) [BR:kus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:kus03009]
    B9G99_11330
Enzymes [BR:kus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     B9G99_11330
Ribosome biogenesis [BR:kus03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    B9G99_11330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Ubie_methyltran Methyltransf_32 Methyltransf_12 MTS Methyltransf_9 CheR TPMT Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: ARS53377
UniProt: A0A2Z2HDS9
Position
2453077..2453916
Genome map
AA seq 279 aa AA seqDB search
MTIAPFTSLICPLDSAPLSRTHTGWCCPQGHSFDVSRQGHVNLLPVQNKRSRDPGDSKPM
IAARRRFLDAGHYQGIAEAVSRRVLAHGAAHEALAVLDAGCGEGYYLRELARSASARRLS
MLGLDISKWAVQAAAGRDRRMQWVVGSNAALPVPDQSLDVVLCMFGFPTPAEFARVLKPG
GLLLEVEAGPDHLRELREIIYPTLKAPREARQAPEAGFEIDTVDSVRHARTLDSHEQILD
LLVMTPHLYRASAEGRAKAEALGHLDITVEAQLISSLRL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgcaccctttacgtcactgatctgcccgctggacagtgcgccgctgtcgcgt
actcataccggctggtgctgcccacagggccacagttttgatgtgtcgcgccaggggcat
gtcaatctgctgccggttcagaacaagcgctcccgtgacccgggtgacagcaagcccatg
atcgctgcgcggcggcgctttctggacgccggtcactatcaaggcattgccgaggcagtc
agtcgtcgggtgctcgcccacggcgcggcccacgaggcgcttgccgtactggatgccggc
tgcggcgaagggtattacctgcgtgaactggcccggtcggcttcggcccgaaggctctcc
atgctggggctggatatctccaagtgggcggtgcaggccgccgccgggcgtgaccggcgc
atgcagtgggtggtgggcagcaatgccgcgctgccggtaccggaccagagcctggatgtg
gtgctgtgcatgttcgggttcccgacgcctgccgagtttgcccgcgtgctaaagcccggc
ggactgttgctggaggtcgaagccggccccgaccacctacgtgagctgcgcgaaattatc
tatccaacgctcaaggcgccccgcgaagcgcgtcaggcgcccgaggccggttttgaaatc
gacactgtcgactccgtacgccatgcccgcacgctggacagtcatgagcagattcttgat
ctactggtgatgacgccgcatctctaccgcgccagcgccgaggggcgggcgaaggccgag
gcgcttggccatctggatatcacggtcgaggcgcagctcattagcagcctgcgcctgtag

DBGET integrated database retrieval system