KEGG   Kushneria konosiri: B9G99_12890Help
Entry
B9G99_12890       CDS       T04839                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kus  Kushneria konosiri
Pathway
kus00020  Citrate cycle (TCA cycle)
kus00640  Propanoate metabolism
kus00660  C5-Branched dibasic acid metabolism
kus01100  Metabolic pathways
kus01110  Biosynthesis of secondary metabolites
kus01120  Microbial metabolism in diverse environments
kus01130  Biosynthesis of antibiotics
kus01200  Carbon metabolism
Module
kus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kus_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B9G99_12890
   00640 Propanoate metabolism
    B9G99_12890
   00660 C5-Branched dibasic acid metabolism
    B9G99_12890
Enzymes [BR:kus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B9G99_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ARS53644
UniProt: A0A2Z2H8H0
Position
2792619..2793785
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQSKQLFADYGLPVSKGYAVDTPEEAAKACQKIGGERWVVKAQVHAGGRGKAGGV
KLVTSPEEASAFAEQWLGKNLVTYQTDEKGQPVTKILVENCTDIATELYLGAVVDRGSRR
IVFMASTEGGVEIEKVAEETPEKILKAEIDPLVGPQPYQARELAFKLGLNKEQIKQFTKI
FLGLAKMFADKDFALLEINPLVITESGDLHCLDAKINLDSNALYRHPDLEEMRDPSQEDE
REANAQKWELNYVALDGNIGCMVNGAGLAMGTMDIIKLSGGQPANFLDVGGGATKERVAE
AFKIILSDTSVKAVLVNIFGGIVRCDMIAEGIMGAVEQVGVNVPVVVRLEGNNAELGTQK
LADSGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagtcaaaacagttatttgctgattatggtctgccggtctcc
aaagggtacgcggtagatacccccgaagaagcagccaaggcatgccagaaaattggcggg
gaacgctgggtagtcaaggcacaggtacacgccggtggtcgcggcaaggcaggcggtgtc
aagctggtcaccagccccgaagaagccagcgctttcgccgagcagtggctgggcaagaac
cttgtcacctatcagacggatgaaaagggccagccggtcacaaagattctggtcgaaaac
tgcaccgatatcgccaccgagctgtatctgggtgcggtagtggatcgtggttcacgtcgc
atcgtgttcatggcctccaccgaaggtggtgtcgagatcgaaaaggtggctgaagagaca
ccggaaaagatcctcaaggccgaaatcgatcctctggtcgggccgcagccctaccaggcg
cgtgaactggcgttcaagctgggcctgaacaaggaacagatcaagcagttcaccaagatt
ttcctgggtctggcaaaaatgtttgccgacaaggattttgcactgctggagatcaacccg
ctggtcattaccgaaagcggcgatctgcactgcctggatgccaagatcaacctggacagc
aacgcgctgtatcgtcatcccgatcttgaagagatgcgcgatcccagccaggaagacgag
cgtgaagccaacgcccagaagtgggaactcaactacgtggcgctcgatggcaacattggc
tgcatggtcaacggcgcaggcttggccatgggcacgatggacatcatcaagctctccggc
ggtcagccggccaacttccttgatgttggcggcggtgctaccaaggaacgtgtcgcggaa
gcgttcaagatcatcctgtccgatacctcggtaaaagccgtactggtcaatatctttggc
ggtatcgtgcgttgcgacatgattgccgaaggcatcatgggtgccgtagagcaggttggt
gtcaacgtgccggtcgttgttcgccttgaaggcaataacgcagagcttggcacgcaaaag
cttgccgatagcggcctcaacatcattgcagcaaccagcctgaccgatgcggcgcagcag
gtggttaaagcagcggagggcaaataa

DBGET integrated database retrieval system