KEGG   Kushneria konosiri: B9G99_15880Help
Entry
B9G99_15880       CDS       T04839                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
kus  Kushneria konosiri
Pathway
kus00040  Pentose and glucuronate interconversions
kus00053  Ascorbate and aldarate metabolism
kus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B9G99_15880
   00053 Ascorbate and aldarate metabolism
    B9G99_15880
Enzymes [BR:kus01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     B9G99_15880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARS54178
UniProt: A0A2Z2H9X8
Position
complement(3423750..3425327)
Genome map
AA seq 525 aa AA seqDB search
MQLTGELLIGQHAIKGTREPVQAINPATGETLEPAYSGGSSNEVEQACALAWQAFDPYRE
TSLEDRAVFLETIAEEIESIGDALIERAVAETGLPQARIQGERGRTCGQLRLFARVVRDG
EWLDVRVDPAMPDRQPMPRADLRQRHIGLGPVVVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHGAHPGTSELVGRAIQKAVSRCGLPEGVFSLLYGSGRDVGTALVADKRIKAAGFT
GSRNGGMALWKVAQSRDEPIPFYAEMSSINPVFPLPEALKARGRDMGKAFVGSLNMGAGQ
FCTNPGLVIAIKGEALETFKQAATEALADANAQTMLTPGISEAYQEGVERLSGHNGITEL
GRGPVGEGMNACQAGLYATSAQTFLADTELQDEVFGATSLIVECVDSDELKAVAEHLEGQ
LTATLQMDDADLESARALVPILERKAGRILVNGWPTGVEVCDAMVHGGPFPATSDGRTTS
VGTAAIKRFLRPVCYQSLPDALLPEALREANPLGLDRLVDGRREG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgacaggcgaacttcttatcggacagcacgccatcaagggcacacgcgaaccg
gttcaggccatcaacccggcaaccggtgaaacgctggaaccggcgtacagcggtggtagc
agcaatgaagtcgaacaggcctgtgcgctggcctggcaggcctttgatccataccgcgag
acctcgcttgaagaccgcgccgtgtttctggagaccatagccgaggagatcgaatccatc
ggtgatgcgctcatcgagcgtgcggtggccgaaaccggcctgccgcaggcacgtattcag
ggcgagcgcgggcgtacctgtggtcagctgagactctttgctcgcgttgtacgtgacggg
gagtggctggacgtgcgcgttgacccggccatgccggatcgtcagccgatgccgcgtgcc
gatctgcgccagcgtcacatcgggctgggcccggtcgtggtcttcggcgccagcaacttc
ccgctggccttctcggtcgccggtggcgacacggcctctgcactggccgccggctgcccg
gtcatcgtcaaggcccacggtgcccatccgggcacgtccgagctggtcggacgcgccatt
caaaaggcggtctcgcgctgtgggctgccggaaggcgttttctccctgctgtacggctcc
gggcgtgacgtgggaacagccctggtcgccgacaagcgtatcaaggcggctggtttcacc
ggttcgcgcaatggcggcatggcgctctggaaggtggcccagtcacgggacgagcccatt
cccttctacgccgagatgagcagcatcaacccggtgttcccgctgccggaggcgctcaag
gcgcgcggtcgcgacatgggcaaggcgtttgtggggtcgctgaacatgggcgcgggtcag
ttctgcaccaacccggggctggtcatcgccatcaagggcgaggcgcttgagaccttcaag
caggccgcgaccgaagcactggccgatgccaacgcccagaccatgctcacccccggtatc
agcgaggcctatcaggaaggcgttgagcgtctgtccggccataatggaattacagagctg
ggccgcggtccggtcggcgaaggcatgaatgcgtgtcaggccgggctgtacgccacctcg
gcgcagacgtttctggccgacaccgagcttcaggatgaagtcttcggggccacgtcactg
atcgttgaatgcgtggacagcgatgagttgaaagccgtcgccgagcatctggaagggcaa
ttgaccgcgaccctgcagatggatgacgccgaccttgaaagcgctcgtgcactggtgccc
attcttgagcgcaaggccggtcgtattctggtcaacggctggccgaccggtgtcgaggtc
tgtgacgccatggtgcatggcggcccgttcccggccacttccgatggtcgtaccacctcg
gtcggcacggcggcgatcaagcgctttttgcgcccggtctgctatcagagcctgccggat
gccctgctgccggaagcgctgcgtgaggccaatcccctgggccttgatcgactggtggat
ggcaggcgcgaaggctga

DBGET integrated database retrieval system