KEGG   Klebsiella variicola At-22: Kvar_0256Help
Entry
Kvar_0256         CDS       T01170                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00520  Amino sugar and nucleotide sugar metabolism
kva01100  Metabolic pathways
kva01503  Cationic antimicrobial peptide (CAMP) resistance
Module
kva_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Kvar_0256
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Kvar_0256
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kva01005]
    Kvar_0256
Enzymes [BR:kva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     Kvar_0256
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     Kvar_0256
Lipopolysaccharide biosynthesis proteins [BR:kva01005]
 Unusual sugar
  Kvar_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10 Sacchrp_dh_NADP NAD_binding_4 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADC56187
Position
284691..286676
Genome map
AA seq 661 aa AA seqDB search
MKAVVFAYHDMGCTGIQSLLDAGYDIAAIFTHPDNPGENHFFGSVARLAAEQGIPVWAPE
DVNHPLWIERIREMKPDVLFSFYYRNLLGDEILNLAPKGAFNLHGSLLPKYRGRAPLNWV
LVNGESETGVTLHRMVNRADAGDIVAQQTVAIGPDDAALTLHRKLCAAATELLGQALPAI
LEGKTAERPQDHSQATYVGRRTPEDGRLDWEQPAQTLHNLVRAVSDPWPGAFGYAGANKF
IVWKSRVRHDLPAAKPGTVISVAPLIVACQDGALEIVTGQTERGVYMQGAQLAQALGLVS
GAVISSKPVVAIKRRTRVLILGVNGFIGNHLTERLLQDDNYEIYGLDIGSDAISRFLESP
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYNKRIIFPSTSEVYGMCTDKNFDEDTSNLVVGPINKQRWIYSVSKQLLDRVIWAYGDK
YDLKFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIEGGKQKRCFTDI
SDGIEALFRIIENKDGRCDGQIINIGNPENEASIKELAEMLLACFERHPLRDRFPPFAGF
REVESSDYYGKGYQDVEHRKPSIRNAKRCLNWEPKVEMEETVEHTLDFFLRTVELVDDKN
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagtcttcgcttatcacgatatgggctgcaccggtatccagtccctgctg
gacgccgggtatgatatcgctgctattttcacccacccggataaccctggcgaaaaccat
ttctttggctccgtggcgcgccttgccgccgagcagggcattccggtgtgggcgccggaa
gacgtgaaccatccgctgtggattgagcgtatccgcgagatgaagccggacgtgctgttc
tccttctactaccgcaacctgctgggcgatgagatcctcaatctggcgccgaaaggggca
tttaacctgcacggttcgctgctgccgaaatatcgtggccgtgcgccgctgaactgggtg
ctggtcaatggcgaaagcgaaaccggcgtcaccctgcaccgcatggtgaaccgcgcggat
gccggcgatatcgtcgcccagcaaaccgtggcgattggcccggatgacgcggccctgacg
ctgcatcgtaagctgtgcgccgccgccactgagctgctgggccaggcgttgccggcgatc
cttgaaggaaaaaccgcagagcgcccgcaggatcacagccaggcgacctacgtggggcgt
cgtaccccggaggatggccgcctcgactgggagcagccggcgcagaccctgcacaatctg
gtgcgtgccgtctcggatccgtggccgggcgccttcggctacgctggcgcgaacaagttt
atcgtctggaaatcccgcgtccgccacgatctgccggcagccaaaccgggtaccgttatc
tccgttgcgccgctgatcgtggcgtgccaggacggggcgctggaaattgtcaccggccag
accgaacgcggtgtgtacatgcagggcgctcagctggcgcaggcgctgggcctggtgtcc
ggggcggtgatcagcagcaaaccggtggtggcgattaagcgtcgcacccgcgtgctgatc
cttggcgtcaatggctttatcggtaaccatttgaccgagcgcctgctgcaggacgacaac
tatgaaatttacggcctggatatcggctccgacgccatcagccgtttccttgagagcccg
cgtttccacttcgtggaaggcgatatcagcattcactccgagtggatcgagtatcacatt
aagaaatgcgacgtggtgttgccgctggtggccattgccacccctatcgaatacacccgc
aacccgctgcgcgtgttcgagctggatttcgaagagaacctgaagatcatccgcgattgc
gtgaaatacaataagcgcatcatcttcccgtcgacctctgaagtgtatggcatgtgcacg
gataaaaacttcgacgaagatacctccaatctggtggtcgggccgatcaacaaacagcgc
tggatctactcggtctccaaacagctgctggatcgcgtgatttgggcctacggcgataag
tacgatcttaagttcaccctgttccgtccgttcaactggatggggccgcgcctggataac
ctcaacgccgcgcgcatcggtagttcccgcgccatcacccagctgatcctcaacctggtg
gaagggtcgccgatcaagctcatcgagggcggcaagcagaagcgctgcttcaccgatatc
agcgacggtatcgaagcgctgttccgcatcatcgagaacaaagacggccgctgcgacggg
cagatcatcaacatcggcaacccggaaaacgaagcgagcatcaaagagctggccgaaatg
ctgctcgcctgcttcgaacgccatccgctgcgcgatcgcttcccgccgtttgccggcttc
cgtgaagtggaaagcagcgattactacgggaagggctaccaggacgttgagcatcgtaag
ccgagcattcgcaacgccaaacgctgcctgaactgggaaccgaaggtggagatggaagaa
acggtcgaacacacgctggacttcttcctgcgtacagttgaactggtggacgataaaaat
ccatga

DBGET integrated database retrieval system