KEGG   Klebsiella variicola At-22: Kvar_0462Help
Entry
Kvar_0462         CDS       T01170                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00620  Pyruvate metabolism
kva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kvar_0462
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kva02000]
    Kvar_0462
Enzymes [BR:kva01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Kvar_0462
Transporters [BR:kva02000]
 Other transporters
  Primary active transporters [TC:3]
   Kvar_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ADC56392
Position
487734..489503
Genome map
AA seq 589 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQAALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTQYDTGLDIHKLESIAAYFREVRKKYHAFEGQLKGTDSRILVAQVPGGML
TNLESQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLDGADPVTCRPADLLKPELAQLEADVRRQAQEK
GITLAENAIDDVLTVALFPQPGLKFLENRHNPAAFEPVPQAEAAQPLAKAEKPAASGIYT
VEVEGKAFVVKVSDGGDVSQLSAAPVAAAPAAAPAPAGAGTPVTAPLAGTIWKVLAAEGQ
TVAEGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLLQLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtccctgttcgccacc
cgtctgcgtctcgacgatatgctccccgtcgccgctcagctggatgacgtcggctaccgc
tcccttgagtgctggggcggcgccacctttgacgcctgcatccgcttcctcggcgaggac
ccgtgggtccgcctgcgtgagctgaaaaaggcgatgccgaagaccccgctgcagatgctg
ctccgcggccagaacctgctcggctaccgccactacgccgatgacgtggtggagcgcttc
gtggagcgcgccgtcaaaaacggcatggacgtcttccgcgtcttcgacgccatgaacgac
ccgcgcaacatgcaggccgccctgcaggcggtccgccgccacggcgcccacgcccagggt
acgctttcgtacaccaccagcccggcgcacaccctgcagacctggctcgacctcaccgaa
cagctgctggagaccggcgttgactccgtcgccatcaaggacatgtccggcattctgacg
ccgcatgccgcctttgagctggtcagcgaaatcaaaaaacgctacgacgtcaccctgcac
ctgcactgccatgccaccaccgggatggcggagatggcgctgctgaaggccattgaagcc
ggggtcgacggcgtcgacaccgccatctcctcgatgagcgccacctacggccacccggcc
accgaggcgctggtcgccaccctcgccggcacgcaatatgacaccgggctggatatccac
aagctggagagcatcgccgcgtacttccgcgaggtgcgtaagaagtaccacgccttcgaa
ggccagctgaagggcaccgacagccgcatcctcgtcgcccaggtcccgggcgggatgctc
accaacctcgaaagccagctgaagcagcagagcgccgcccaccgtctggatgaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggtttcatcccgctggtcaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggcgagcgctacaaaaccatc
gcgaaggagaccgccggtatcctgaagggtgagtacggccgcaccccggcgccggtgaac
gccgccctgcaggcgcgggtgcttgacggcgctgacccggtgacctgccgcccggccgac
ctgctgaagccggagctggcgcagctggaagccgacgtcagacgccaggcgcaggagaaa
ggcatcacccttgccgaaaacgccatcgacgacgtgctcaccgtggccctgttcccgcag
cccggcctgaagttcctcgaaaaccgccacaacccggcagcctttgagccggtaccgcag
gcggaagccgcgcagccgctggcaaaagcagaaaaaccagccgcctccggtatctacacc
gtggaggtggaaggcaaagcctttgtggtcaaagtcagcgacggcggcgacgtcagccag
ctcagcgccgcgccggtggccgctgcgcctgctgccgccccggctccggccggcgccggc
accccggtgaccgccccgctggcgggcactatctggaaggtgctggccgcggaaggccag
acggtggccgaaggcgaggtgctgctgattctggaagccatgaagatggagaccgaaatc
cgcgccgcgcaggccgggaccgtgcgcggcatcgcggtgaaagccggcgacgcggtggcg
gtcggcgacactctgctgcagctggcgtaa

DBGET integrated database retrieval system