KEGG   Klebsiella variicola At-22: Kvar_0809Help
Entry
Kvar_0809         CDS       T01170                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00052  Galactose metabolism
kva00500  Starch and sucrose metabolism
kva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Kvar_0809
   00500 Starch and sucrose metabolism
    Kvar_0809
Enzymes [BR:kva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Kvar_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ADC56739
Position
843589..845025
Genome map
AA seq 478 aa AA seqDB search
MMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYS
TQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHG
DPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMIVGAREG
DTGQVRLYRSTDLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAEGFR
NRNLFQSGYLIGEWQPGQRFIRHGEFREMDHGHDFYAPQSFATPDGRRIVIGWLDMWESP
LPEQQDGWAGMLSLPRELSLSADGRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNC
EAMEVHLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVVERHYPQFGLCGTRSVPLTAG
ADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQVPCRELALFAWSGSAALTEAGAWQLE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgctc
aatctgcgctggtatccacactatcacctggcggcccgcgccgggtggatcaacgaccct
aacggtctggtgtggttcgacggctggtaccatgccttttatcagcatcacccgtattcc
acccagtgggggccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggag
cacctgccggtggcgctggcgccggaggggccggaagataaagacggctgcttctccggt
tcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggc
gatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacggg
atccactttgagcgccaggggatggtggtcgacacccctccaggcatgcaccacttccgc
gacccgaaggtctggcgggaaggggatagctggtacatgatcgtcggcgcgcgcgaaggc
gataccggccaggtgcggctgtaccgttcaaccgatctgcgccagtggcaggatgcgggc
gtgctggatgaagcggaaagcaccatgggctacatgtgggagtgcccggacttcttcacc
ctcaacggtaagcgcgtcctgatgttttccccgcaggggatgcaggccgaagggttccgc
aaccgcaacctgttccagagcggctatctgatcggcgagtggcagccggggcagcgtttt
attcgccacggcgaattcagggagatggaccacggccacgatttctatgccccgcaaagt
ttcgccacccccgatggccggcggatcgtaattggctggctggatatgtgggaatcgccg
ctaccggaacagcaggacggctgggcgggcatgctctccctgccgcgcgagttgagcctg
agcgccgatggccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcc
tggttcccgtggccggtcagcacgctgaacaaccagcagacgacgatggtcgacaactgc
gaggcgatggaagtgcacctgcgctgggactgcgcccgcagcagcgctgagcagtatggt
ctgcgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctggtggtg
gagcggcattatccgcagtttggcctgtgcgggacgcgcagcgtgccgttgaccgccggg
gcggatctcaacctgcggatatttttcgatagctcttcggttgaggttttcgtcaatgat
ggcgaagcctgcctgagcagccgtatctatccgcaggtcccttgccgtgaattagcgtta
tttgcctggagcggctcagctgcattaactgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system