KEGG   Klebsiella variicola At-22: Kvar_1250Help
Entry
Kvar_1250         CDS       T01170                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00300  Lysine biosynthesis
kva01100  Metabolic pathways
kva01120  Microbial metabolism in diverse environments
kva01230  Biosynthesis of amino acids
Module
kva_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Kvar_1250
Enzymes [BR:kva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Kvar_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ADC57177
Position
complement(1319597..1320724)
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGDTQNFWAWRGHGET
LAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQYPN
HRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIANVQSGT
GSNNVIPGDMFVQFNFRFSTELTDEMIKARVVSLLEKYQLRYSVEWWLSGQPFLTGRGKL
VDAVVSAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRVMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcccggtcattgagctggctcagcagcttattcgccgcccttcccttagcccc
gatgatgcgggatgccaggcgttaatgattgaacgcctgcgtgcgatcggctttaccgtt
gaaccgatggatttcggcgatacacagaatttctgggcctggcgcggccacggcgagacg
ctggccttcgccggccacaccgacgtggtcccggcaggcgacgccgaccgctggatcaac
cccccgttcgaaccgaccatccgcgacggcatgctgttcggccgcggcgcagctgatatg
aaaggctcgctggcggcgatggtggtggcggcggaacgttttgtcgcgcagtacccgaat
catcgcggcagactggcgttcttgatcacctcagatgaagaggccagcgccaaaaacggc
accgtcaaagtggtggaaacgctgatggcgcgtaatgagcgtctggactactgtctggtc
ggcgaaccctccagtaccgaggtggtcggcgatgtggtgaaaaacggccgccgcggctcg
ctgacctgcaacctgaccattcacggcgtgcagggccatgttgcctatccgcaccttgcc
gataaccctgtccatcgcgcggcgccgatgctggcggagctggtcaatatcgagtgggat
aaaggcaatgaatttttcccgccaacaagcatgcagatcgccaacgtacagtccggtacc
ggcagcaacaacgtgatccccggcgatatgttcgtccagttcaacttccgcttcagtacg
gaactgacggacgagatgatcaaagcccgcgtggtctccctgctggaaaaataccagctg
cgttacagcgtggagtggtggctctccggccagccgttcctcaccgggcgcggtaaactg
gtggatgcggtggtgagcgcaattgagcactataatgagatcaaaccgcagctgttgacc
aacggcggcacctctgacggtcggtttatcgcccgcatgggggcgcaggtggttgagttg
ggccccgtgaacgcaaccattcacaaaattaatgaatgtgtgaacgccgccgacctgcag
ctgctggcacggatgtatcaacgcgtaatggaacagctggtcgcctga

DBGET integrated database retrieval system